StarFunc result for job id A3QJZ6

User Input

>input (481 residues)
MRMSLQAPRRLLELAGQSLLGDQALAISILDELPRELFPPLFVEAFTSRRCEVLKVMVQA
WPFPCLPLGSLMKTPDLEILHYVVDGIDCLLAQKVRPRRWKLQVLELRDVDENFWTIWSG
ARPLSCSPEAMSKRQTVEDCPRTGEKQPLKVFMDVCLKEKFMDEDLSFFSGWVQHRRGSV
HLCCTKVVNYSMSILNFRNILETVYPDSIQVLEIWNMCWPCMIVEFSRYLSQMRNLRKLF
ISDGCRYLLSSDSQEQLVAEFSSVLLRLEYLQMLYVRRVCFFRGHLDQLIRCLRSPLETL
ALTYGFLEKVDLKCLPRYPSLSQLKQLNLSHGALRFIRLEPLRALLEKVAATLQTLFLVD
CGIRDSKLRVILPALSCCSNLTTFCFHGNDTSMDGLKDLLRHTGRLSNLSLETYPAPRES
LDDRGRVISELLTPLQAELMRILREVREPKRIFFGPVSCPCCGTSPTEQLEFNFCLWGRP
A

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DUQ2	0.874	0.879	1.235E-46	478	0.478	0.481	P0DUQ2.pdb.gz	PRAM9_HUMAN PRAME family member 9 OS=Homo sapiens OX=9606 GN=PRAMEF9 PE=1 SV=1
2	AFDB:A0A024R1E6	0.846	0.801	3.934E-43	509	0.443	0.418	A0A024R1E6.pdb.gz
3	AFDB:E9Q5G7	0.745	0.725	6.089E-36	496	0.370	0.359	E9Q5G7.pdb.gz	OOG1_MOUSE Oogenesin-1 OS=Mus musculus OX=10090 GN=Oog1 PE=1 SV=1
4	AFDB:Q810Y8	0.771	0.774	1.415E-35	479	0.318	0.319	Q810Y8.pdb.gz	PRAL7_MOUSE Preferentially expressed antigen in melanoma-like protein 7 OS=Mus musculus OX=10090 GN=Pramel7 PE=1 SV=1
5	AFDB:Q99MW3	0.735	0.769	3.921E-34	458	0.341	0.358	Q99MW3.pdb.gz	PRAL1_MOUSE Preferentially expressed antigen in melanoma-like protein 1 OS=Mus musculus OX=10090 GN=Pramel1 PE=1 SV=1
6	AFDB:Q15048	0.556	0.544	1.385E-24	493	0.256	0.249	Q15048.pdb.gz	LRC14_HUMAN Leucine-rich repeat-containing protein 14 OS=Homo sapiens OX=9606 GN=LRRC14 PE=1 SV=1
7	AFDB:Q3UP24	0.421	0.232	1.355E-10	1024	0.154	0.072	Q3UP24.pdb.gz	NLRC4_MOUSE NLR family CARD domain-containing protein 4 OS=Mus musculus OX=10090 GN=Nlrc4 PE=1 SV=1
8	AFDB:Q9NPP4	0.398	0.221	2.735E-9	1024	0.160	0.075	Q9NPP4.pdb.gz	NLRC4_HUMAN NLR family CARD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRC4 PE=1 SV=2
9	PDB:4kxfP	0.388	0.240	2.059E-8	866	0.154	0.085	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
10	AFDB:P59047	0.326	0.157	1.040E-7	1200	0.156	0.062	P59047.pdb.gz	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
11	AFDB:Q9R1M5	0.415	0.191	1.585E-7	1163	0.158	0.065	Q9R1M5.pdb.gz	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5 OS=Mus musculus OX=10090 GN=Nlrp5 PE=1 SV=2
12	PDB:7sa1B	0.371	0.300	2.368E-6	624	0.168	0.130	7sa1B.pdb.gz
13	PDB:7p5vB	0.282	0.204	6.118E-6	732	0.116	0.077	7p5vB.pdb.gz
14	PDB:1a4yA	0.340	0.351	7.963E-6	460	0.133	0.139	1a4yA.pdb.gz
15	PDB:4i6jB	0.318	0.364	2.168E-5	394	0.131	0.160	4i6jB.pdb.gz
16	PDB:3oglB	0.264	0.233	3.136E-5	568	0.121	0.102	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
17	PDB:1k5dC	0.345	0.452	7.291E-5	344	0.083	0.116	1k5dC.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
18	PDB:6o60C	0.391	0.474	7.686E-5	389	0.091	0.113	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
19	PDB:3jblA	0.367	0.221	8.102E-5	909	0.125	0.066	3jblA.pdb.gz
20	PDB:7pzcA	0.346	0.194	1.373E-4	1010	0.164	0.078	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DUQ2	3.93e-143	421	478	0.495	0.498	PRAM9_HUMAN PRAME family member 9 OS=Homo sapiens OX=9606 GN=PRAMEF9 PE=1 SV=1
2	Q5VXH4	7.15e-141	415	476	0.495	0.500	PRAM6_HUMAN PRAME family member 6 OS=Homo sapiens OX=9606 GN=PRAMEF6 PE=1 SV=1
3	P78395	2.82e-114	348	509	0.449	0.424	PRAME_HUMAN Melanoma antigen preferentially expressed in tumors OS=Homo sapiens OX=9606 GN=PRAME PE=1 SV=1
4	Q99MW3	1.95e-85	272	458	0.351	0.369	PRAL1_MOUSE Preferentially expressed antigen in melanoma-like protein 1 OS=Mus musculus OX=10090 GN=Pramel1 PE=1 SV=1
5	E9Q5G7	1.60e-81	263	496	0.368	0.357	OOG1_MOUSE Oogenesin-1 OS=Mus musculus OX=10090 GN=Oog1 PE=1 SV=1
6	Q810Y8	1.22e-77	252	479	0.320	0.322	PRAL7_MOUSE Preferentially expressed antigen in melanoma-like protein 7 OS=Mus musculus OX=10090 GN=Pramel7 PE=1 SV=1
7	Q15048	3.32e-28	119	493	0.237	0.231	LRC14_HUMAN Leucine-rich repeat-containing protein 14 OS=Homo sapiens OX=9606 GN=LRRC14 PE=1 SV=1
8	Q0GKD5	0.056	38.5	1196	0.052	0.021	NL1B5_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 5 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
9	Q2LKU9	0.056	38.5	1182	0.052	0.021	NLR1A_MOUSE NACHT, LRR and PYD domains-containing protein 1a OS=Mus musculus OX=10090 GN=Nlrp1a PE=1 SV=1
10	Q2LKV2	0.069	38.1	906	0.052	0.028	NL1B4_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 4 OS=Mus musculus OX=10090 GN=Nlrp1b PE=2 SV=1
11	Q2LKW6	0.074	38.1	1233	0.052	0.020	NL1B1_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 1 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
12	Q2LKV5	0.083	38.1	1172	0.052	0.021	NL1B3_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 3 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
13	Q38C53	0.10	37.7	1594	0.077	0.023	Q38C53_TRYB2 Calpain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5950 PE=4 SV=1
14	A1Z198	0.42	35.8	1177	0.050	0.020	NL1B2_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 2 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
15	Q9M651	0.82	34.7	545	0.050	0.044	RAGP2_ARATH RAN GTPase-activating protein 2 OS=Arabidopsis thaliana OX=3702 GN=RANGAP2 PE=1 SV=2
16	D9I2F9	1.4	34.3	1218	0.048	0.019	NL1A1_RAT NACHT, LRR and PYD domains-containing protein 1a allele 1 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=1 SV=1
17	D9I2G3	1.4	34.3	1218	0.048	0.019	NL1A2_RAT NACHT, LRR and PYD domains-containing protein 1 allele 2 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=1 SV=1
18	D9I2G4	1.5	33.9	1218	0.048	0.019	NL1A5_RAT NACHT, LRR and PYD domains-containing protein 1a allele 5 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
19	D9I2G1	1.6	33.9	1218	0.048	0.019	NL1A4_RAT NACHT, LRR and PYD domains-containing protein 1a allele 4 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
20	D9I2H0	1.6	33.9	1218	0.048	0.019	NL1A3_RAT NACHT, LRR and PYD domains-containing protein 1a allele 3 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12799 LRR_4	2.9e+02	13.3	Leucine Rich repeats (2 copies)
2	PF13855 LRR_8	3.8e+02	12.3	Leucine rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000485473

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365322	0.543	PRAME family member 9
2	9606.ENSP00000346275	0.534	PRAME family member 20
3	9606.ENSP00000480122	0.534	PRAME family member 5
4	9606.ENSP00000365360	0.531	PRAME family member 6
5	9606.ENSP00000478309	0.531	Belongs to the PRAME family
6	9606.ENSP00000370800	0.506	methyl-CpG binding domain protein 3 like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990756	1.000	ubiquitin ligase-substrate adaptor activity
GO:0005515	0.997	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006511	0.998	ubiquitin-dependent protein catabolic process
GO:0010498	0.960	proteasomal protein catabolic process
GO:0043161	0.952	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0065007	0.853	biological regulation
GO:0050789	0.626	regulation of biological process
GO:0050794	0.505	regulation of cellular process
GO:0048518	0.355	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005622	0.975	intracellular anatomical structure
GO:0043229	0.936	intracellular organelle
GO:0043231	0.930	intracellular membrane-bounded organelle
GO:0005634	0.895	nucleus
GO:0016020	0.889	membrane
GO:0005737	0.881	cytoplasm
GO:0032991	0.781	protein-containing complex
GO:0031462	0.737	Cul2-RING ubiquitin ligase complex
GO:0071944	0.615	cell periphery
GO:0005886	0.563	plasma membrane
GO:0070013	0.506	intracellular organelle lumen
GO:0031981	0.483	nuclear lumen
GO:0005654	0.419	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]