StarFunc result for job id A4D0S4

User Input

>input (1761 residues)
MQFQLTLFLHLGWLSYSKAQDDCNRGACHPTTGDLLVGRNTQLMASSTCGLSRAQKYCIL
SYLEGEQKCFICDSRFPYDPYDQPNSHTIENVIVSFEPDREKKWWQSENGLDHVSIRLDL
EALFRFSHLILTFKTFRPAAMLVERSTDYGHNWKVFKYFAKDCATSFPNITSGQAQGVGD
IVCDSKYSDIEPSTGGEVVLKVLDPSFEIENPYSPYIQDLVTLTNLRINFTKLHTLGDAL
LGRRQNDSLDKYYYALYEMIVRGSCFCNGHASECRPMQKMRGDVFSPPGMVHGQCVCQHN
TDGPNCERCKDFFQDAPWRPAADLQDNACRSCSCNSHSSRCHFDMTTYLASGGLSGGVCE
DCQHNTEGQHCDRCRPLFYRDPLKTISDPYACIPCECDPDGTISGGICVSHSDPALGSVA
GQCLCKENVEGAKCDQCKPNHYGLSATDPLGCQPCDCNPLGSLPFLTCDVDTGQCLCLSY
VTGAHCEECTVGYWGLGNHLHGCSPCDCDIGGAYSNVCSPKNGQCECRPHVTGRSCSEPA
PGYFFAPLNFYLYEAEEATTLQGLAPLGSETFGQSPAVHVVLGEPVPGNPVTWTGPGFAR
VLPGAGLRFAVNNIPFPVDFTIAIHYETQSAADWTVQIVVNPPGGSEHCIPKTLQSKPQS
FALPAATRIMLLPTPICLEPDVQYSIDVYFSQPLQGESHAHSHVLVDSLGLIPQINSLEN
FCSKQDLDEYQLHNCVEIASAMGPQVLPGACERLIISMSAKLHDGAVACKCHPQGSVGSS
CSRLGGQCQCKPLVVGRCCDRCSTGSYDLGHHGCHPCHCHPQGSKDTVCDQVTGQCPCHG
EVSGRRCDRCLAGYFGFPSCHPCPCNRFAELCDPETGSCFNCGGFTTGRNCERCIDGYYG
NPSSGQPCRPCLCPDDPSSNQYFAHSCYQNLWSSDVICNCLQGYTGTQCGECSTGFYGNP
RISGAPCQPCACNNNIDVTDPESCSRVTGECLRCLHNTQGANCQLCKPGHYGSALNQTCR
RCSCHASGVSPMECPPGGGACLCDPVTGACPCLPNVTGLACDRCADGYWNLVPGRGCQSC
DCDPRTSQSSHCDQLTGQCPCKLGYGGKRCSECQENYYGDPPGRCIPCDCNRAGTQKPIC
DPDTGMCRCREGVSGQRCDRCARGHSQEFPTCLQCHLCFDQWDHTISSLSKAVQGLMRLA
ANMEDKRETLPVCEADFKDLRGNVSEIERILKHPVFPSGKFLKVKDYHDSVRRQIMQLNE
QLKAVYEFQDLKDTIERAKNEADLLLEDLQEEIDLQSSVLNASIADSSENIKKYYHISSS
AEKKINETSSTINTSANTRNDLLTILDTLTSKGNLSLERLKQIKIPDIQILNEKVCGDPG
NVPCVPLPCGGALCTGRKGHRKCRGPGCHGSLTLSTNALQKAQEAKSIIRNLDKQVRGLK
NQIESISEQAEVSKNNALQLREKLGNIRNQSDSEEENINLFIKKVKNFLLEENVPPEDIE
KVANGVLDIHLPIPSQNLTDELVKIQKHMQLCEDYRTDENRLNEEADGAQKLLVKAKAAE
KAANILLNLDKTLNQLQQAQITQGRANSTITQLTANITKIKKNVLQAENQTREMKSELEL
AKQRSGLEDGLSLLQTKLQRHQDHAVNAKVQAESAQHQAGSLEKEFVELKKQYAILQRKT
STTGLTKETLGKVKQLKDAAEKLAGDTEAKIRRITDLERKIQDLNLSRQAKADQLRILED
QVVAIKNEIVEQEKKYARCYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IDN1	0.224	0.221	0.000	1785	0.411	0.405	A0A0R4IDN1.pdb.gz
2	AFDB:B7ZDA6	0.232	0.229	0.000	1782	0.417	0.412	B7ZDA6.pdb.gz	B7ZDA6_DANRE Laminin subunit beta-2 precursor OS=Danio rerio OX=7955 GN=si:dkey-32e6.2 PE=1 SV=1
3	AFDB:D3ZQN7	0.239	0.236	0.000	1786	0.408	0.403	D3ZQN7.pdb.gz	D3ZQN7_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=3
4	AFDB:O44565	0.339	0.335	0.000	1790	0.357	0.351	O44565.pdb.gz	O44565_CAEEL Laminin subunit beta-1 OS=Caenorhabditis elegans OX=6239 GN=lam-1 PE=1 SV=3
5	AFDB:P11046	0.228	0.225	0.000	1788	0.360	0.355	P11046.pdb.gz	LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=LanB1 PE=1 SV=4
6	AFDB:P55268	0.242	0.238	0.000	1798	0.402	0.394	P55268.pdb.gz	LAMB2_HUMAN Laminin subunit beta-2 OS=Homo sapiens OX=9606 GN=LAMB2 PE=1 SV=2
7	AFDB:Q61292	0.224	0.220	0.000	1799	0.406	0.397	Q61292.pdb.gz	LAMB2_MOUSE Laminin subunit beta-2 OS=Mus musculus OX=10090 GN=Lamb2 PE=1 SV=2
8	AFDB:Q9Y6N6	0.222	0.245	1.694E-77	1575	0.240	0.269	Q9Y6N6.pdb.gz	LAMC3_HUMAN Laminin subunit gamma-3 OS=Homo sapiens OX=9606 GN=LAMC3 PE=1 SV=3
9	AFDB:P11047	0.202	0.219	6.312E-77	1609	0.241	0.264	P11047.pdb.gz	LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3
10	AFDB:Q9R0B6	0.238	0.260	1.068E-76	1581	0.234	0.261	Q9R0B6.pdb.gz	LAMC3_MOUSE Laminin subunit gamma-3 OS=Mus musculus OX=10090 GN=Lamc3 PE=1 SV=2
11	PDB:2waaA	0.043	0.196	1.590E-3	335	0.009	0.045	2waaA.pdb.gz
12	PDB:8a3tA	0.056	0.387	3.500E-3	219	0.011	0.087	8a3tA.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
13	PDB:4bxsV	0.063	0.084	5.924E-3	1262	0.018	0.025	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
14	PDB:7ufgB	0.053	0.073	6.582E-3	1182	0.043	0.064	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
15	PDB:1k12A	0.068	0.619	6.937E-3	158	0.013	0.146	1k12A.pdb.gz	A novel fucose recognition fold involved in innate immunity.
16	PDB:1xpwA	0.054	0.575	6.937E-3	143	0.011	0.133	1xpwA.pdb.gz
17	PDB:7ufgA	0.044	0.064	7.312E-3	1151	0.055	0.083	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
18	PDB:7z8bC	0.056	0.079	1.057E-2	1224	0.009	0.013	7z8bC.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
19	PDB:8a7eC	0.045	0.051	1.237E-2	1524	0.067	0.077	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
20	PDB:4fixA	0.053	0.125	1.788E-2	629	0.009	0.025	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZQ25	0.0	1362	1834	0.417	0.401	A0A8I5ZQ25_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
2	A0A8I5ZVQ5	0.0	1330	1741	0.403	0.407	A0A8I5ZVQ5_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
3	A0A8I6A3T2	0.0	1363	1792	0.417	0.410	A0A8I6A3T2_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
4	B7ZDA6	0.0	1443	1782	0.429	0.424	B7ZDA6_DANRE Laminin subunit beta-2 precursor OS=Danio rerio OX=7955 GN=si:dkey-32e6.2 PE=1 SV=1
5	D3ZQN7	0.0	1363	1786	0.417	0.412	D3ZQN7_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=3
6	F1MNT4	0.0	1380	1786	0.425	0.419	F1MNT4_BOVIN Laminin subunit beta 1 OS=Bos taurus OX=9913 GN=LAMB1 PE=4 SV=3
7	O44565	0.0	1072	1790	0.363	0.358	O44565_CAEEL Laminin subunit beta-1 OS=Caenorhabditis elegans OX=6239 GN=lam-1 PE=1 SV=3
8	P02469	0.0	1365	1786	0.416	0.410	LAMB1_MOUSE Laminin subunit beta-1 OS=Mus musculus OX=10090 GN=Lamb1 PE=1 SV=3
9	P07942	0.0	1390	1786	0.417	0.411	LAMB1_HUMAN Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2
10	P11046	0.0	1119	1788	0.372	0.366	LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=LanB1 PE=1 SV=4
11	P55268	0.0	1293	1798	0.404	0.395	LAMB2_HUMAN Laminin subunit beta-2 OS=Homo sapiens OX=9606 GN=LAMB2 PE=1 SV=2
12	Q61292	0.0	1328	1799	0.408	0.399	LAMB2_MOUSE Laminin subunit beta-2 OS=Mus musculus OX=10090 GN=Lamb2 PE=1 SV=2
13	Q8JHV7	0.0	1363	1785	0.420	0.414	Q8JHV7_DANRE Laminin beta 1 OS=Danio rerio OX=7955 GN=lamb1 PE=1 SV=1
14	Q01635	2.88e-132	416	303	0.106	0.614	LAMB1_CHICK Laminin subunit beta-1 (Fragment) OS=Gallus gallus OX=9031 GN=LAMB1 PE=1 SV=1
15	F1LPI5	8.17e-126	427	1172	0.126	0.189	F1LPI5_RAT Laminin subunit beta 3 OS=Rattus norvegicus OX=10116 GN=Lamb3 PE=4 SV=2
16	Q61087	9.18e-126	427	1168	0.128	0.193	LAMB3_MOUSE Laminin subunit beta-3 OS=Mus musculus OX=10090 GN=Lamb3 PE=1 SV=2
17	Q13751	7.54e-125	424	1172	0.131	0.196	LAMB3_HUMAN Laminin subunit beta-3 OS=Homo sapiens OX=9606 GN=LAMB3 PE=1 SV=1
18	Q18823	3.31e-97	350	1633	0.238	0.257	LAM2_CAEEL Laminin-like protein lam-2 OS=Caenorhabditis elegans OX=6239 GN=lam-2 PE=1 SV=3
19	Q9HB63	1.20e-96	328	628	0.106	0.298	NET4_HUMAN Netrin-4 OS=Homo sapiens OX=9606 GN=NTN4 PE=1 SV=2
20	F1MMT2	4.73e-95	344	1964	0.206	0.184	F1MMT2_BOVIN Laminin subunit alpha 2 OS=Bos taurus OX=9913 GN=LAMA2 PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00053 Laminin_EGF	1.5e-111	375.7	Laminin EGF domain
2	PF00055 Laminin_N	1.4e-68	242.5	Laminin N-terminal (Domain VI)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373433

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367316	0.739	Integrin alpha-8
2	9606.ENSP00000200181	0.735	Integrin beta-4
3	9606.ENSP00000377779	0.734	Synaptic vesicle glycoprotein 2B
4	9606.ENSP00000258341	0.725	Laminin subunit gamma-1
5	9606.ENSP00000252999	0.724	Laminin subunit alpha-5
6	9606.ENSP00000324532	0.721	Laminin subunit alpha-3
7	9606.ENSP00000374309	0.720	Laminin subunit alpha-1
8	9606.ENSP00000261023	0.716	Integrin alpha-V
9	9606.ENSP00000264741	0.695	Integrin alpha-9
10	9606.ENSP00000283249	0.695	Integrin beta-6
11	9606.ENSP00000293379	0.690	Integrin alpha-5
12	9606.ENSP00000222573	0.683	Integrin beta-8
13	9606.ENSP00000296585	0.679	Integrin alpha-2
14	9606.ENSP00000386896	0.677	Integrin alpha-6
15	9606.ENSP00000452786	0.676	Integrin beta-3
16	9606.ENSP00000358310	0.665	Integrin alpha-10
17	9606.ENSP00000452120	0.665	Integrin alpha-7
18	9606.ENSP00000296181	0.664	Integrin beta-5
19	9606.ENSP00000282588	0.663	Integrin alpha-1
20	9606.ENSP00000379350	0.659	Integrin beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.999	structural molecule activity
GO:0044877	0.579	protein-containing complex binding
GO:0050839	0.398	cell adhesion molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0048856	0.995	anatomical structure development
GO:0009987	0.993	cellular process
GO:0007275	0.975	multicellular organism development
GO:0030154	0.923	cell differentiation
GO:0048731	0.720	system development
GO:0009653	0.711	anatomical structure morphogenesis
GO:0050789	0.644	regulation of biological process
GO:0071840	0.572	cellular component organization or biogenesis
GO:0048513	0.562	animal organ development
GO:0016043	0.561	cellular component organization
GO:0050794	0.548	regulation of cellular process
GO:0007399	0.499	nervous system development
GO:0050896	0.452	response to stimulus
GO:0007155	0.425	cell adhesion
GO:0009888	0.366	tissue development
GO:0022008	0.332	neurogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.997	collagen-containing extracellular matrix
GO:0032991	0.994	protein-containing complex
GO:0005604	0.988	basement membrane
GO:0005576	0.986	extracellular region
GO:0005886	0.952	plasma membrane
GO:0043226	0.796	organelle
GO:0043227	0.793	membrane-bounded organelle
GO:0030054	0.751	cell junction
GO:0005622	0.713	intracellular anatomical structure
GO:0043229	0.669	intracellular organelle
GO:0005737	0.641	cytoplasm
GO:0043231	0.634	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]