StarFunc result for job id A4D0V7

User Input

>input (1026 residues)
MVCRPVFPCRRRFCPRPFLVGLVVAICLFYQTLTLRGSRKLTAAAPGAVPHTSTETQASR
CKKGFSQDKQCFLLSGNAQETRKVKESMETHFGSHGRRAILYRPPFYSKTELQLHQHILT
QHGYTVVIAEERLNAGLGPGLLEQGDLGSWDLLICLSSKKAEGTPCISKEVMCQLGLHQK
ANRLPEIQQPLCRKEGLCQIVRRFPELQLPVSPSVCLDQGMQLKPSTSSHLLKTVKPRVW
KPGDWSREQLNETTVLAPHETIFRAEDLSVILKAYVLVTSLTPLRAFIHSTGTVWNPPKK
KRFTVKLQTFFETFLRASSPQQAFDIMKEAIGKLLLAAEVFSETSTLGPKTFHRCRFCFQ
LLTFDIGYGSFMYPVVLQVHEHLNFQDYDNMDFEDQNTEEFLLNDTFNFLFPNESSLSIF
SEIFQRLYRSDVFKGENYQKELNQCLSLEEINSIMTFIKELGSLGQFQLLFPSTTPGIQS
LMHEFYDVANPVGNPGSVLTQYWSLLNVFEQFQFMNKKTQPHPLEWNSFTEDKNIEKPQV
PFDAIENKKAAVPQIKNENKEIHCSDDENTPCHIKQIFTHPHLELNPDFHPKIKDYYCEV
PFDVVTVTIGVETPKCLCKVHLYEQAGPSFASYPLGLGMNKISIFVVDESPAHGETLITY
KLTIYREDRPSLPLFEAFTACGFVQDCGLLIHPEETCGLQPISSDYIEAILQSELKRCPS
GDMKGQWIVPCLSCSDNRTCDWREITWQPHNCQYGVLTKPQLQQCLGGRKILFIGDSTNR
GIMYYLIERLNETLQEWQKVHGTKFYHNVNGGKTLISYSYYPQFWISPSLRPTFENALEH
LLQRSRPLENTGQTVLVVGGVQWLNSNHLQIIHKVLKRENLLNILVIIKTLGIGFHLPVD
GVHFLTQSEVQNLWKENLIILDTAKKHGYEVVDTFTITMGRYKEFLQGKCGCHFHEVVKS
KLSKEYNFIKMKRSRNHIMGRYFSNQSKLQQGTVTNFRSPYHVRGPINQVCSEILLSRMC
ANKRTM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4D0V7	1.000	1.000	0.000	1026	1.000	1.000	A4D0V7.pdb.gz	CPED1_HUMAN Cadherin-like and PC-esterase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CPED1 PE=2 SV=1
2	AFDB:Q6ZT98	0.244	0.278	3.934E-13	887	0.082	0.095	Q6ZT98.pdb.gz	TTLL7_HUMAN Tubulin polyglutamylase TTLL7 OS=Homo sapiens OX=9606 GN=TTLL7 PE=1 SV=2
3	AFDB:F7E540	0.242	0.269	6.927E-13	909	0.085	0.096	F7E540.pdb.gz	TTLL7_XENTR Tubulin polyglutamylase TTLL7 OS=Xenopus tropicalis OX=8364 GN=ttll7 PE=1 SV=2
4	AFDB:E9P886	0.242	0.329	1.577E-12	730	0.086	0.121	E9P886.pdb.gz	TTLL5_CAEEL Tubulin polyglutamylase ttll-5 OS=Caenorhabditis elegans OX=6239 GN=ttll-5 PE=2 SV=1
5	AFDB:A4Q9F0	0.234	0.260	1.661E-12	912	0.082	0.092	A4Q9F0.pdb.gz	TTLL7_MOUSE Tubulin polyglutamylase TTLL7 OS=Mus musculus OX=10090 GN=Ttll7 PE=1 SV=1
6	AFDB:Q8N841	0.219	0.259	4.891E-12	843	0.095	0.115	Q8N841.pdb.gz	TTLL6_HUMAN Tubulin polyglutamylase TTLL6 OS=Homo sapiens OX=9606 GN=TTLL6 PE=1 SV=2
7	AFDB:A4Q9F6	0.231	0.288	9.545E-12	804	0.087	0.111	A4Q9F6.pdb.gz	TTL13_MOUSE Tubulin polyglutamylase TTLL13 OS=Mus musculus OX=10090 GN=Ttll13 PE=1 SV=1
8	AFDB:Q23MT7	0.239	0.209	1.597E-11	1195	0.090	0.077	Q23MT7.pdb.gz	TTL6A_TETTS Probable beta-tubulin polyglutamylase OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=Ttll6a PE=3 SV=2
9	AFDB:A6NNM8	0.232	0.286	1.681E-11	815	0.080	0.101	A6NNM8.pdb.gz	TTL13_HUMAN Tubulin polyglutamylase TTLL13 OS=Homo sapiens OX=9606 GN=TTLL13 PE=1 SV=2
10	AFDB:A4Q9E8	0.232	0.280	4.030E-11	822	0.092	0.114	A4Q9E8.pdb.gz	TTLL6_MOUSE Tubulin polyglutamylase TTLL6 OS=Mus musculus OX=10090 GN=Ttll6 PE=1 SV=1
11	PDB:8asnF	0.190	0.535	2.795E-7	317	0.048	0.155	8asnF.pdb.gz	Crystal structure of the apo human TTL in complex with tubulin-stathmin
12	PDB:8asnG	0.182	0.465	2.187E-6	346	0.049	0.145	8asnG.pdb.gz	Crystal structure of the apo human TTL in complex with tubulin-stathmin
13	PDB:6cciA	0.176	0.450	1.712E-5	354	0.044	0.127	6cciA.pdb.gz
14	PDB:3lrpA	0.115	0.468	2.388E-3	181	0.021	0.122	3lrpA.pdb.gz	Structure of Plasmodium falciparum ADP-ribosylation factor 1.
15	PDB:1yzgA	0.103	0.455	4.660E-3	168	0.024	0.149	1yzgA.pdb.gz	Structure of Human ADP-ribosylation factor-like 8
16	PDB:6z3eA	0.088	0.302	1.601E-2	237	0.022	0.097	6z3eA.pdb.gz	Crystal structure of GDP-bound human GIMAP5
17	PDB:3vpbB	0.129	0.365	1.775E-2	282	0.028	0.103	3vpbB.pdb.gz	Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus
18	PDB:3doeA	0.099	0.394	1.869E-2	189	0.023	0.127	3doeA.pdb.gz	Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector
19	PDB:2b6hA	0.094	0.416	2.180E-2	171	0.021	0.129	2b6hA.pdb.gz	Structure of human ADP-ribosylation factor 5
20	PDB:2gf0B	0.104	0.430	2.417E-2	174	0.015	0.086	2gf0B.pdb.gz	The crystal structure of the human DiRas1 GTPase in the inactive GDP bound state

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4D0V7	0.0	2134	1026	1.000	1.000	CPED1_HUMAN Cadherin-like and PC-esterase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CPED1 PE=2 SV=1
2	Q9FG35	0.001	45.4	608	0.026	0.044	TBR_ARATH Protein trichome birefringence OS=Arabidopsis thaliana OX=3702 GN=TBR PE=1 SV=1
3	F4IH21	0.003	43.9	425	0.038	0.092	TBL33_ARATH Protein trichome birefringence-like 33 OS=Arabidopsis thaliana OX=3702 GN=TBL33 PE=2 SV=1
4	Q9SRL3	0.013	41.6	451	0.021	0.049	TBL32_ARATH Protein trichome birefringence-like 32 OS=Arabidopsis thaliana OX=3702 GN=TBL32 PE=2 SV=1
5	Q9LHL6	0.028	40.8	556	0.025	0.047	TBL1_ARATH Protein trichome birefringence-like 1 OS=Arabidopsis thaliana OX=3702 GN=TBL1 PE=2 SV=1
6	Q96PB1	0.029	40.8	797	0.018	0.023	CASD1_HUMAN N-acetylneuraminate 9-O-acetyltransferase OS=Homo sapiens OX=9606 GN=CASD1 PE=1 SV=1
7	Q7TN73	0.035	40.4	797	0.018	0.023	CASD1_MOUSE N-acetylneuraminate 9-O-acetyltransferase OS=Mus musculus OX=10090 GN=Casd1 PE=2 SV=1
8	Q84TW8	0.043	40.0	441	0.025	0.059	XOATA_ORYSJ Probable xylan O-acetyltransferase 10 OS=Oryza sativa subsp. japonica OX=39947 GN=XOAT10 PE=1 SV=1
9	Q2QYW3	0.049	39.7	455	0.017	0.037	XOAT3_ORYSJ Xylan O-acetyltransferase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=XOAT3 PE=1 SV=1
10	A0A0P0XXR9	0.053	39.7	476	0.017	0.036	XOAT4_ORYSJ Xylan O-acetyltransferase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=XOAT4 PE=1 SV=1
11	Q8RXQ1	0.061	39.7	449	0.016	0.036	TBL35_ARATH Protein trichome birefringence-like 35 OS=Arabidopsis thaliana OX=3702 GN=TBL35 PE=2 SV=1
12	F7E540	0.15	38.5	909	0.041	0.046	TTLL7_XENTR Tubulin polyglutamylase TTLL7 OS=Xenopus tropicalis OX=8364 GN=ttll7 PE=1 SV=2
13	Q10MX2	0.52	36.6	558	0.024	0.045	XOAT6_ORYSJ Xylan O-acetyltransferase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=XOAT6 PE=1 SV=1
14	Q6UWF7	0.52	36.6	544	0.019	0.035	NXPE4_HUMAN NXPE family member 4 OS=Homo sapiens OX=9606 GN=NXPE4 PE=2 SV=1
15	O80919	0.63	36.2	410	0.015	0.037	TBL34_ARATH Protein trichome birefringence-like 34 OS=Arabidopsis thaliana OX=3702 GN=TBL34 PE=2 SV=2
16	Q2RBL8	0.92	35.8	503	0.015	0.030	XOATC_ORYSJ Xylan O-acetyltransferase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=XOAT12 PE=1 SV=1
17	Q10BH4	0.98	35.4	393	0.019	0.051	XOATB_ORYSJ Probable xylan O-acetyltransferase 11 OS=Oryza sativa subsp. japonica OX=39947 GN=XOAT11 PE=1 SV=1
18	Q2QYU2	0.99	35.8	502	0.015	0.030	XOATD_ORYSJ Xylan O-acetyltransferase 13 OS=Oryza sativa subsp. japonica OX=39947 GN=XOAT13 PE=1 SV=1
19	H9JW44	1.3	35.0	364	0.016	0.044	CDA7_BOMMO Chitin deacetylase 7 OS=Bombyx mori OX=7091 GN=CDA7 PE=1 SV=1
20	Q5W6Y3	1.4	35.0	454	0.015	0.033	XOAT9_ORYSJ Probable xylan O-acetyltransferase 9 OS=Oryza sativa subsp. japonica OX=39947 GN=XOAT9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12733 Cadherin-like	0.068	25.1	Cadherin-like beta sandwich domain
2	PF05876 GpA_ATPase	2.1e+02	12.9	Phage terminase large subunit gpA, ATPase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309772

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353025	0.696	Protein FAM3C
2	9606.ENSP00000222462	0.686	Protein Wnt-16
3	9606.ENSP00000297273	0.605	N-acetylneuraminate 9-O-acetyltransferase
4	9606.ENSP00000323635	0.605	Protein FAM210A
5	9606.ENSP00000376465	0.559	Polypeptide N-acetylgalactosaminyltransferase 3
6	9606.ENSP00000377390	0.557	Serine/threonine-protein phosphatase 6 regulatory subunit 3
7	9606.ENSP00000009041	0.540	STARD3 N-terminal-like protein
8	9606.ENSP00000280756	0.531	Transmembrane protein 263
9	9606.ENSP00000478962	0.505	Protein chibby homolog 1
10	9606.ENSP00000287585	0.500	LHFPL tetraspan subfamily member 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003824	1.000	catalytic activity
GO:0005515	0.997	protein binding
GO:0140096	0.613	catalytic activity, acting on a protein
GO:0016740	0.553	transferase activity
GO:0016879	0.456	ligase activity, forming carbon-nitrogen bonds

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.973	cellular process
GO:0008152	0.965	metabolic process
GO:0071704	0.951	organic substance metabolic process
GO:0043170	0.887	macromolecule metabolic process
GO:0044238	0.877	primary metabolic process
GO:0065007	0.750	biological regulation
GO:0050789	0.663	regulation of biological process
GO:0006807	0.523	nitrogen compound metabolic process
GO:0044237	0.430	cellular metabolic process
GO:0050794	0.404	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.998	endoplasmic reticulum
GO:0016020	0.885	membrane
GO:0005576	0.446	extracellular region
GO:0005794	0.333	Golgi apparatus
GO:0005615	0.318	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.553	Transferases.
EC:6.3.-.-	0.456	Forming carbon-nitrogen bonds.

[back to server]