StarFunc result for job id A4D1E1

User Input

>input (1349 residues)
MACYLVISSRHLSNGHYRGIKGVFRGPLCKNGSPSPDFAEKKSTAKALEDVKANFYCELC
DKQYHKHQEFDNHINSYDHAHKQRLKELKQREFARNVASKSWKDEKKQEKALKRLHQLAE
LRQQSECVSGNGPAYKAPRVAIEKQLQQGIFPIKNGRKVSCMKSALLLKGKNLPRIISDK
QRSTMPNRHQLQSDRRCLFGNQVLQTSSDLSNANHRTGVSFTFSKKVHLKLESSASVFSE
NTEETHDCNKSPIYKTKQTADKCKCCRFANKDTHLTKEKEVNISPSHLESVLHNTISINS
KILQDKHDSIDETLEDSIGIHASFSKSNIHLSDVDFTPTSREKETRNTLKNTLENCVNHP
CQANASFSPPNIYNHSDARISECLDEFSSLEPSEQKSTVHLNPNSRIENREKSLDKTERV
SKNVQRLVKEACTHNVASKPLPFLHVQSKDGHTTLQWPTELLLFTKTEPCISYGCNPLYF
DFKLSRNTKEDHNLEDLKTELGKKPLELKTKRESQVSGLTEDQQKLIQEDYQYPKPKTMI
ANPDWEKFQRKYNLDYSDSEPNKSEYTFSANDLEMKNPKVPLYLNTSLKDCAGKNNSSEN
KLKEASRAHWQGCRKAVLNDIDEDLSFPSYISRFKKHKLIPCSPHLEFEDERQFNCKSSP
CTVGGHSDHGKDFSVILKSNHISMTSKVSGCGNQRYKRYSPQSCLSRYSSSLDTSPSSMS
SLRSTCSSHRFNGNSRGNLLCFHKREHHSVERHKRKCLKHNCFYLSDDITKSSQMQSEPQ
KERNCKLWESFKNEKYSKRRYCHCRERQKLGKNQQQFSGLKSTRIIYCDSNSQISCTGSS
KKPPNCQGTQHDRLDSYSIEKMYYLNKSKRNQESLGSPHICDLGKVRPMKCNSGNISCLL
KNCSSGPSETTESNTAEGERTPLTAKILLERVQAKKCQEQSSNVEISSNSCKSELEAPSQ
VPCTIQLAPSGCNRQALPLSEKIQYASESRNDQDSAIPRTTEKDKSKSSHTNNFTILADT
DCDNHLSKGIIHLVTESQSLNIKRDATTKEQSKPLISEIQPFIQSCDPVPNEFPGAFPSN
KYTGVTDSTETQEDQINLDLQDVSMHINHVEGNINSYYDRTMQKPDKVEDGLEMCHKSIS
PPLIQQPITFSPDEIDKYKILQLQAQQHMQKQLLSKHLRVLPAAGPTAFSPASTVQTVPV
HQHTSITTIHHTFLQHFAVSASLSSHSSHLPIAHLHPLSQAHFSPISFSTLTPTIIPAHP
TFLAGHPLHLVAATPFHPSHITLQPLPPTAFIPTLFGPHLNPATTSIIHLNPLIQPVFQG
QDFCHHSCSSQMQQLNEVKEALNVSTHLN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2A6A1	0.077	0.070	5.655E-36	1505	0.267	0.239	A2A6A1.pdb.gz	GPTC8_MOUSE G patch domain-containing protein 8 OS=Mus musculus OX=10090 GN=Gpatch8 PE=1 SV=1
2	AFDB:Q7Z570	0.104	0.114	2.409E-25	1209	0.245	0.273	Q7Z570.pdb.gz	Z804A_HUMAN Zinc finger protein 804A OS=Homo sapiens OX=9606 GN=ZNF804A PE=2 SV=3
3	AFDB:F1M078	0.100	0.113	3.852E-20	1164	0.232	0.269	F1M078.pdb.gz	F1M078_RAT Zinc finger protein 804A OS=Rattus norvegicus OX=10116 GN=Zfp804a PE=4 SV=4
4	AFDB:H2KYH3	0.036	0.024	6.826E-4	2476	0.143	0.078	H2KYH3.pdb.gz	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
5	AFDB:Q86B80	0.043	0.037	1.893E-3	1744	0.150	0.116	Q86B80.pdb.gz	Q86B80_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7029 PE=4 SV=1
6	AFDB:Q9BYP7	0.044	0.036	3.359E-3	1800	0.118	0.088	Q9BYP7.pdb.gz	WNK3_HUMAN Serine/threonine-protein kinase WNK3 OS=Homo sapiens OX=9606 GN=WNK3 PE=1 SV=3
7	AFDB:Q7KMH9	0.036	0.035	3.580E-3	1420	0.138	0.131	Q7KMH9.pdb.gz	Q7KMH9_DROME BcDNA.LD26050 OS=Drosophila melanogaster OX=7227 GN=wde PE=1 SV=1
8	AFDB:Q92766	0.045	0.038	5.247E-3	1687	0.124	0.099	Q92766.pdb.gz	RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3
9	AFDB:Q387U6	0.039	0.025	8.737E-3	2399	0.141	0.079	Q387U6.pdb.gz	Q387U6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.0660 PE=4 SV=1
10	AFDB:A0A024R657	0.036	0.037	9.925E-3	1257	0.112	0.120	A0A024R657.pdb.gz
11	PDB:6qx91C	0.030	0.534	1.926	50	0.007	0.200	6qx91C.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	PDB:6fvtU	0.048	0.163	2.053	304	0.010	0.046	6fvtU.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
13	PDB:2wj8N	0.019	0.058	2.188	378	0.007	0.024	2wj8N.pdb.gz	Crystal Structure of a Nucleocapsid-Like Nucleoprotein-RNA Complex of Respiratory Syncytial Virus
14	PDB:7s4vA	0.032	0.038	2.332	1122	0.015	0.018	7s4vA.pdb.gz	Structural basis for mismatch surveillance by CRISPR-Cas9.
15	PDB:3gn5A	0.022	0.186	3.010	132	0.004	0.045	3gn5A.pdb.gz	Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
16	PDB:5ondA	0.016	0.139	3.010	135	0.001	0.015	5ondA.pdb.gz	The universally-conserved transcription factor RfaH is recruited to a hairpin structure of the non-template DNA strand.
17	PDB:4p1mB	0.039	0.203	3.419	107	0.011	0.140	4p1mB.pdb.gz
18	PDB:2lxxA	0.023	0.142	3.884	152	0.005	0.046	2lxxA.pdb.gz
19	PDB:4zt9C	0.024	0.026	4.139	1160	0.010	0.011	4zt9C.pdb.gz	A Cas9-guide RNA complex preorganized for target DNA recognition.
20	PDB:2cczA	0.016	0.164	4.412	121	0.003	0.033	2cczA.pdb.gz	Complexed Crystal Structure of Replication Restart Primsome Protein Prib Reveals a Novel Single-Stranded DNA-Binding Mode.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M078	3.65e-81	294	1198	0.154	0.174	F1M078_RAT Zinc finger protein 804A OS=Rattus norvegicus OX=10116 GN=Zfp804a PE=4 SV=4
2	Q9UKJ3	5.31e-49	194	1502	0.079	0.071	GPTC8_HUMAN G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8 PE=1 SV=2
3	A2A6A1	4.54e-47	187	1505	0.079	0.071	GPTC8_MOUSE G patch domain-containing protein 8 OS=Mus musculus OX=10090 GN=Gpatch8 PE=1 SV=1
4	Q147M4	1.66e-09	63.2	301	0.019	0.083	Q147M4_ARATH At5g26610 OS=Arabidopsis thaliana OX=3702 GN=At5g26610 PE=1 SV=1
5	Q7Z570	2.48e-09	64.7	1209	0.023	0.026	Z804A_HUMAN Zinc finger protein 804A OS=Homo sapiens OX=9606 GN=ZNF804A PE=2 SV=3
6	A0A1D8PGH4	0.48	37.4	2624	0.018	0.009	A0A1D8PGH4_CANAL 1-phosphatidylinositol-3-phosphate 5-kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FAB1 PE=4 SV=1
7	Q99102	0.85	36.6	5412	0.022	0.006	MUC4_HUMAN Mucin-4 OS=Homo sapiens OX=9606 GN=MUC4 PE=1 SV=5
8	Q57ZI7	2.4	34.3	260	0.013	0.069	Q57ZI7_TRYB2 60S ribosomal protein L19, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27E10.170 PE=1 SV=1
9	A1L3A9	3.0	34.7	1232	0.024	0.027	A1L3A9_HUMAN TBC1 domain family, member 9B (With GRAM domain) OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=1
10	Q66K14	3.3	34.7	1250	0.024	0.026	TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B PE=1 SV=3
11	Q09776	3.5	33.1	173	0.017	0.133	SNU23_SCHPO U4/U6.U5 small nuclear ribonucleoprotein component snu23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snu23 PE=3 SV=4
12	Q32SG5	4.3	34.3	616	0.034	0.075	RIK_MAIZE Protein RIK OS=Zea mays OX=4577 PE=1 SV=1
13	Q15652	5.3	33.9	2540	0.019	0.010	JHD2C_HUMAN Probable JmjC domain-containing histone demethylation protein 2C OS=Homo sapiens OX=9606 GN=JMJD1C PE=1 SV=2
14	B7YZS4	6.6	33.9	1842	0.036	0.027	B7YZS4_DROME Calmodulin-binding transcription activator, isoform E OS=Drosophila melanogaster OX=7227 GN=Camta PE=3 SV=1
15	Q7KUB3	6.8	33.5	1616	0.014	0.012	Q7KUB3_DROME Ecdysone-inducible gene E1, isoform A OS=Drosophila melanogaster OX=7227 GN=ImpE1 PE=4 SV=1
16	A1Z7V0	7.3	33.5	1881	0.036	0.026	A1Z7V0_DROME Calmodulin-binding transcription activator, isoform D OS=Drosophila melanogaster OX=7227 GN=Camta PE=3 SV=3
17	Q9VSJ0	7.5	33.5	1616	0.014	0.012	Q9VSJ0_DROME Ecdysone-inducible gene E1 OS=Drosophila melanogaster OX=7227 GN=ImpE1 PE=2 SV=2
18	O54836	8.1	32.7	290	0.018	0.083	ZMAT3_MOUSE Zinc finger matrin-type protein 3 OS=Mus musculus OX=10090 GN=Zmat3 PE=2 SV=1
19	Q8BIT2	8.1	33.1	719	0.013	0.024	Q8BIT2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Ciz1 PE=2 SV=1
20	A8JQX6	8.7	32.7	362	0.012	0.044	A8JQX6_DROME Transcription factor Ouib OS=Drosophila melanogaster OX=7227 GN=Dmel\CG4820 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11931 SF3a60_Prp9_C	2.2	20.2	SF3a60/Prp9 C-terminal
2	PF12171 zf-C2H2_jaz	0.0016	29.9	Zinc-finger double-stranded RNA-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329638

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346659	0.589	P protein
2	9606.ENSP00000246194	0.562	RNA-binding protein Raly
3	9606.ENSP00000450114	0.556	Uncharacterized protein CLBA1
4	9606.ENSP00000361001	0.553	EF-hand calcium-binding domain-containing protein 14
5	9606.ENSP00000355577	0.543	Putative thiamine transporter SLC35F3
6	9606.ENSP00000389072	0.507	Olfactory receptor 10G8
7	9606.ENSP00000409316	0.504	Olfactory receptor 4F3/4F16/4F29
8	9606.ENSP00000302199	0.502	Olfactory receptor 10V1
9	9606.ENSP00000323853	0.502	Olfactory receptor 8K5
10	9606.ENSP00000329982	0.502	Olfactory receptor, family 4, subfamily F, member 16

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.968	regulation of cellular process
GO:0048518	0.930	positive regulation of biological process
GO:0048522	0.909	positive regulation of cellular process
GO:0051128	0.866	regulation of cellular component organization
GO:0019222	0.836	regulation of metabolic process
GO:0060255	0.802	regulation of macromolecule metabolic process
GO:0009987	0.740	cellular process
GO:0051171	0.607	regulation of nitrogen compound metabolic process
GO:0051130	0.507	positive regulation of cellular component organization
GO:0071704	0.351	organic substance metabolic process
GO:0010604	0.338	positive regulation of macromolecule metabolic process
GO:0120035	0.309	regulation of plasma membrane bounded cell projection organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.996	nucleus
GO:0016020	0.837	membrane
GO:0005737	0.697	cytoplasm
GO:0120025	0.379	plasma membrane bounded cell projection
GO:0030424	0.367	axon
GO:0031981	0.346	nuclear lumen
GO:0005654	0.304	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]