StarFunc result for job id A4D1E9

User Input

>input (387 residues)
MVHCSCVLFRKYGNFIDKLRLFTRGGSGGMGYPRLGGEGGKGGDVWVVAQNRMTLKQLKD
RYPRKRFVAGVGANSKISALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQ
GGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAF
TTLKPELGKIMYSDFKQISVADLPGLIEGAHMNKGMGHKFLKHIERTRQLLFVVDISGFQ
LSSHTQYRTAFETIILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPK
DFLHLFEKNMIPERTVEFQHIIPISAVTGEGIEELKNCIRKSLDEQANQENDALHKKQLL
NLWISDTMSSTEPPSKHAVTTSKMDII

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4D1E9	1.000	1.000	4.885E-84	387	1.000	1.000	A4D1E9.pdb.gz	GTPBA_HUMAN GTP-binding protein 10 OS=Homo sapiens OX=9606 GN=GTPBP10 PE=1 SV=1
2	AFDB:Q8K013	0.921	0.974	1.114E-69	366	0.778	0.822	Q8K013.pdb.gz	GTPBA_MOUSE GTP-binding protein 10 OS=Mus musculus OX=10090 GN=Gtpbp10 PE=2 SV=1
3	PDB:7oi6y	0.402	0.453	1.158E-40	331	0.842	0.985	7oi6y.pdb.gz	A distinct assembly pathway of the human 39S late pre-mitoribosome.
4	AFDB:Q38AM0	0.746	0.620	3.500E-33	472	0.307	0.252	Q38AM0.pdb.gz	Q38AM0_TRYB2 GTP-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3230 PE=3 SV=1
5	AFDB:A2AFK4	0.407	0.390	8.436E-32	405	0.323	0.309	A2AFK4.pdb.gz	A2AFK4_MOUSE Mitochondrial ribosome associated GTPase 2 OS=Mus musculus OX=10090 GN=Mtg2 PE=1 SV=1
6	AFDB:Q5F5D9	0.477	0.481	1.613E-31	384	0.326	0.328	Q5F5D9.pdb.gz	OBG_NEIG1 GTPase Obg OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=obg PE=1 SV=1
7	AFDB:P9WMT1	0.442	0.363	4.393E-31	479	0.300	0.242	P9WMT1.pdb.gz	OBG_MYCTU GTPase Obg OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=obg PE=1 SV=1
8	AFDB:Q9H4K7	0.411	0.393	5.242E-31	406	0.336	0.320	Q9H4K7.pdb.gz	MTG2_HUMAN Mitochondrial ribosome-associated GTPase 2 OS=Homo sapiens OX=9606 GN=MTG2 PE=1 SV=1
9	AFDB:Q0D3S3	0.441	0.237	1.196E-30	752	0.328	0.169	Q0D3S3.pdb.gz	OBGC1_ORYSJ Probable GTP-binding protein OBGC1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=OBGC1 PE=3 SV=1
10	AFDB:P42641	0.387	0.384	6.608E-30	390	0.346	0.344	P42641.pdb.gz	OBG_ECOLI GTPase ObgE/CgtA OS=Escherichia coli (strain K12) OX=83333 GN=obgE PE=1 SV=1
11	AFDB:Q8L7L0	0.438	0.259	6.608E-30	681	0.313	0.178	Q8L7L0.pdb.gz	OBGC_ARATH GTP-binding protein OBGC, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OBGL PE=2 SV=1
12	PDB:7o9kG	0.394	0.444	3.563E-27	337	0.336	0.386	7o9kG.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
13	PDB:7odtt	0.366	0.441	5.337E-25	316	0.297	0.364	7odtt.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
14	PDB:7bl29P1	0.382	0.427	2.935E-23	338	0.313	0.358	7bl29P1.pdb.gz	Snapshots of native pre-50S ribosomes reveal a biogenesis factor network and evolutionary specialization.
15	PDB:6n8jb	0.362	0.230	2.176E-8	647	0.119	0.071	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
16	PDB:6lss4	0.361	0.237	1.069E-7	620	0.116	0.073	6lss4.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
17	PDB:1mozA	0.301	0.576	2.299E-7	178	0.124	0.270	1mozA.pdb.gz	Structures of Yeast ARF2 and ARL1: DISTINCT ROLES FOR THE N TERMINUS IN THE STRUCTURE AND FUNCTION OF ARF FAMILY GTPases
18	PDB:4zi2A	0.312	0.601	2.438E-7	185	0.119	0.249	4zi2A.pdb.gz	The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
19	PDB:5uf8A	0.291	0.610	3.907E-7	161	0.098	0.236	5uf8A.pdb.gz	Crystal structure of the ARF family small GTPase ARF2 from Candida albicans in complex with GDP
20	PDB:1uptG	0.330	0.684	4.946E-7	170	0.096	0.218	1uptG.pdb.gz	Structural Basis for Arl1-Dependent Targeting of Homodimeric Grip Domains to the Golgi Apparatus

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4D1E9	0.0	796	387	1.000	1.000	GTPBA_HUMAN GTP-binding protein 10 OS=Homo sapiens OX=9606 GN=GTPBP10 PE=1 SV=1
2	Q8K013	0.0	610	366	0.778	0.822	GTPBA_MOUSE GTP-binding protein 10 OS=Mus musculus OX=10090 GN=Gtpbp10 PE=2 SV=1
3	Q9H4K7	2.13e-51	179	406	0.328	0.313	MTG2_HUMAN Mitochondrial ribosome-associated GTPase 2 OS=Homo sapiens OX=9606 GN=MTG2 PE=1 SV=1
4	P42641	2.36e-45	162	390	0.274	0.272	OBG_ECOLI GTPase ObgE/CgtA OS=Escherichia coli (strain K12) OX=83333 GN=obgE PE=1 SV=1
5	Q5L6R9	8.61e-45	159	335	0.282	0.325	OBG_CHLAB GTPase Obg OS=Chlamydia abortus (strain DSM 27085 / S26/3) OX=218497 GN=obg PE=3 SV=1
6	A2AFK4	5.24e-44	159	405	0.256	0.244	A2AFK4_MOUSE Mitochondrial ribosome associated GTPase 2 OS=Mus musculus OX=10090 GN=Mtg2 PE=1 SV=1
7	Q0D3S3	3.17e-42	159	752	0.269	0.138	OBGC1_ORYSJ Probable GTP-binding protein OBGC1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=OBGC1 PE=3 SV=1
8	Q5F5D9	2.09e-40	149	384	0.320	0.323	OBG_NEIG1 GTPase Obg OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=obg PE=1 SV=1
9	P9WMT1	8.70e-39	146	479	0.284	0.230	OBG_MYCTU GTPase Obg OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=obg PE=1 SV=1
10	Q8L7L0	1.02e-38	149	681	0.251	0.142	OBGC_ARATH GTP-binding protein OBGC, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OBGL PE=2 SV=1
11	Q38AM0	6.83e-34	133	472	0.248	0.203	Q38AM0_TRYB2 GTP-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3230 PE=3 SV=1
12	Q9UT06	4.07e-32	127	419	0.217	0.200	YLWB_SCHPO Uncharacterized GTP-binding protein P8A3.11c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAP8A3.11c PE=3 SV=1
13	P38860	3.92e-27	114	518	0.204	0.153	MTG2_YEAST GTPase MTG2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTG2 PE=1 SV=2
14	Q9CAI1	3.48e-12	69.7	399	0.124	0.120	DRG2_ARATH Developmentally-regulated G-protein 2 OS=Arabidopsis thaliana OX=3702 GN=DRG2 PE=2 SV=1
15	Q9LQK0	7.71e-12	68.6	399	0.124	0.120	DRG1_ARATH Developmentally-regulated G-protein 1 OS=Arabidopsis thaliana OX=3702 GN=DRG1 PE=1 SV=1
16	P39729	1.54e-11	67.4	369	0.098	0.103	RBG1_YEAST Ribosome-interacting GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RBG1 PE=1 SV=1
17	P32234	3.00e-11	66.6	368	0.103	0.109	128UP_DROME GTP-binding protein 128up OS=Drosophila melanogaster OX=7227 GN=128up PE=2 SV=2
18	Q5A779	3.66e-11	66.2	368	0.101	0.106	Q5A779_CANAL GTP-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DRG1 PE=4 SV=1
19	Q9SVA6	4.45e-11	66.2	369	0.124	0.130	DRG3_ARATH Developmentally-regulated G-protein 3 OS=Arabidopsis thaliana OX=3702 GN=DRG3 PE=1 SV=1
20	Q38AS7	5.92e-11	65.9	368	0.109	0.114	Q38AS7_TRYB2 Developmentally regulated GTP-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3970 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00025 Arf	1.2	20.1	ADP-ribosylation factor family
2	PF00350 Dynamin_N	6.2e+02	11.8	Dynamin family
3	PF02421 FeoB_N	1.7e-05	35.9	Ferrous iron transport protein B
4	PF01018 GTP1_OBG	7e-15	66.5	GTP1/OBG
5	PF00009 GTP_EFTU	0.25	22.4	Elongation factor Tu GTP binding domain
6	PF19275 HflX_C	23	16.4	HflX C-terminal domain
7	PF03308 MeaB	0.11	23.0	Methylmalonyl Co-A mutase-associated GTPase MeaB
8	PF01926 MMR_HSR1	5.1e-19	79.8	50S ribosome-binding GTPase
9	PF16897 MMR_HSR1_Xtn	99	14.4	C-terminal region of MMR_HSR1 domain
10	PF12631 MnmE_helical	70	15.0	MnmE helical domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222511

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357643	0.901	Proliferation marker protein Ki-67
2	9606.ENSP00000419370	0.844	Mitochondrial assembly of ribosomal large subunit protein 1
3	9606.ENSP00000301585	0.810	Peptidyl-tRNA hydrolase ICT1, mitochondrial
4	9606.ENSP00000361092	0.769	Surfeit locus protein 6
5	9606.ENSP00000364320	0.748	mRNA turnover protein 4 homolog
6	9606.ENSP00000362153	0.736	Nucleolar GTP-binding protein 2
7	9606.ENSP00000263629	0.733	Translation initiation factor IF-2, mitochondrial
8	9606.ENSP00000254928	0.710	GTPase Era, mitochondrial
9	9606.ENSP00000364398	0.702	Intracellular hyaluronan-binding protein 4
10	9606.ENSP00000354040	0.700	Nucleolar GTP-binding protein 1
11	9606.ENSP00000298317	0.691	Mitochondrial RNA pseudouridine synthase RPUSD4
12	9606.ENSP00000323047	0.686	Mitochondrial ribosome-associated GTPase 1
13	9606.ENSP00000264151	0.656	Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial
14	9606.ENSP00000225969	0.654	Mitochondrial ribosomal protein L27
15	9606.ENSP00000355086	0.653	Aspartate--tRNA ligase, mitochondrial
16	9606.ENSP00000281543	0.648	Translation factor GUF1, mitochondrial
17	9606.ENSP00000354580	0.648	Mitochondrial ribosomal protein L21
18	9606.ENSP00000455106	0.636	Ribosome biogenesis protein BOP1
19	9606.ENSP00000361982	0.631	Mitochondrial mRNA pseudouridine synthase TRUB2
20	9606.ENSP00000245539	0.624	Mitochondrial ribosomal protein S7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.999	RNA binding
GO:0003824	0.962	catalytic activity
GO:0016462	0.733	pyrophosphatase activity
GO:0017111	0.697	ribonucleoside triphosphate phosphatase activity
GO:0003924	0.553	GTPase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0071704	0.915	organic substance metabolic process
GO:0044238	0.912	primary metabolic process
GO:0044237	0.911	cellular metabolic process
GO:0065007	0.904	biological regulation
GO:0006807	0.894	nitrogen compound metabolic process
GO:0050789	0.892	regulation of biological process
GO:0043170	0.776	macromolecule metabolic process
GO:0050794	0.690	regulation of cellular process
GO:0034641	0.686	cellular nitrogen compound metabolic process
GO:0010467	0.580	gene expression
GO:1901564	0.453	organonitrogen compound metabolic process
GO:0071840	0.450	cellular component organization or biogenesis
GO:0044260	0.422	cellular macromolecule metabolic process
GO:1901576	0.380	organic substance biosynthetic process
GO:0044249	0.368	cellular biosynthetic process
GO:0019538	0.356	protein metabolic process
GO:0044271	0.350	cellular nitrogen compound biosynthetic process
GO:0043603	0.309	amide metabolic process
GO:0019222	0.306	regulation of metabolic process
GO:0046483	0.305	heterocycle metabolic process
GO:0006139	0.301	nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.987	intracellular organelle lumen
GO:0016020	0.807	membrane
GO:0005759	0.751	mitochondrial matrix
GO:0005829	0.431	cytosol
GO:0043232	0.386	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	0.733	In phosphorus-containing anhydrides.
RHEA:23680	0.697	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.697	nucleoside-triphosphate phosphatase.
RHEA:19669	0.553	GTP + H2O = GDP + H(+) + phosphate

[back to server]