StarFunc result for job id A4D1P6

User Input

>input (747 residues)
MAEAVERTDELVREYLLFRGFTHTLRQLDAEIKADKEKGFRVDKIVDQLQQLMQVYDLAA
LRDYWSYLERRLFSRLEDIYRPTIHKLKTSLFRFYLVYTIQTNRNDKAQEFFAKQATELQ
NQAEWKDWFVLPFLPSPDTNPTFATYFSRQWADTFIVSLHNFLSVLFQCMPVPVILNFDA
ECQRTNQVQEENEVLRQKLFALQAEIHRLKKEEQQPEEEEALVQHKLPPYVSNMDRLGDS
ELAMVCSQRNASLSQSPRVGFLSSLLPQSKKSPSRLSPAQGPPQPQSSAKKESFGGQGTK
GKDPTSGAKDGKSLLSGLATGESGWSQHRQRRLQDHGKERKELFSTTTSQCAEKKPEASG
PEAEPCPELHTEPVEPLTRASSAGPEGGGVRPEQPFIVLGQEEYGEHHSSIMHCRVDCSG
RRVASLDVDGVIKVWSFNPIMQTKASSISKSPLLSLEWATKRDRLLLLGSGVGTVRLYDT
EAKKNLCEININDNMPRILSLACSPNGASFVCSAAAPSLTSQVDFSAPDIGSKGMNQVPG
RLLLWDTKTMKQQLQFSLDPEPIAINCTAFNHNGNLLVTGAADGVIRLFDMQQHECAMSW
RAHYGEVYSVEFSYDENTVYSIGEDGKFIQWNIHKSGLKVSEYSLPSDATGPFVLSGYSG
YKQVQVPRGRLFAFDSEGNYMLTCSATGGVIYKLGGDEKVLESCLSLGGHRAPVVTVDWS
TAMDCGTCLTASMDGKIKLTTLLAHKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4D1P6	1.000	1.000	0.000	747	1.000	1.000	A4D1P6.pdb.gz	WDR91_HUMAN WD repeat-containing protein 91 OS=Homo sapiens OX=9606 GN=WDR91 PE=1 SV=2
2	AFDB:P16649	0.334	0.347	3.302E-23	713	0.155	0.163	P16649.pdb.gz	TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TUP1 PE=1 SV=2
3	PDB:5mzhB	0.353	0.604	1.755E-20	415	0.095	0.171	5mzhB.pdb.gz
4	PDB:7vggA	0.349	0.810	9.560E-20	304	0.083	0.204	7vggA.pdb.gz
5	PDB:5yzgs	0.365	0.704	3.362E-19	374	0.070	0.139	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
6	AFDB:P78972	0.356	0.529	6.928E-19	488	0.110	0.168	P78972.pdb.gz	SLP1_SCHPO WD repeat-containing protein slp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=slp1 PE=1 SV=1
7	PDB:3jcmB	0.357	0.603	8.996E-19	429	0.072	0.126	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
8	PDB:2h9lA	0.348	0.770	1.060E-18	321	0.084	0.196	2h9lA.pdb.gz
9	AFDB:Q384A9	0.249	0.151	1.854E-18	1370	0.166	0.091	Q384A9.pdb.gz	Q384A9_TRYB2 non-specific serine/threonine protein kinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0930 PE=4 SV=1
10	PDB:8gqeA	0.352	0.717	2.542E-18	348	0.079	0.170	8gqeA.pdb.gz
11	PDB:3jb9L	0.350	0.853	2.836E-18	293	0.068	0.174	3jb9L.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
12	PDB:3zwlD	0.328	0.652	3.529E-18	352	0.071	0.151	3zwlD.pdb.gz
13	PDB:5nnzA	0.342	0.718	4.900E-18	335	0.074	0.164	5nnzA.pdb.gz
14	AFDB:Q9M0E5	0.314	0.163	5.238E-18	1494	0.149	0.074	Q9M0E5.pdb.gz	VPS15_ARATH Serine/threonine-protein kinase VPS15 OS=Arabidopsis thaliana OX=3702 GN=VPS15 PE=1 SV=1
15	AFDB:Q9WVB3	0.350	0.444	5.533E-18	581	0.103	0.133	Q9WVB3.pdb.gz	TLE6_MOUSE Transducin-like enhancer protein 6 OS=Mus musculus OX=10090 GN=Tle6 PE=1 SV=1
16	AFDB:Q8VZS9	0.347	0.531	7.681E-18	475	0.094	0.147	Q8VZS9.pdb.gz	FZR1_ARATH Protein FIZZY-RELATED 1 OS=Arabidopsis thaliana OX=3702 GN=FZR1 PE=1 SV=1
17	PDB:5o9zL	0.346	0.547	8.465E-18	459	0.066	0.107	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
18	AFDB:O13286	0.346	0.456	1.066E-17	556	0.116	0.156	O13286.pdb.gz	SRW1_SCHPO WD repeat-containing protein srw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=srw1 PE=1 SV=1
19	AFDB:Q5JSH3	0.361	0.299	1.564E-17	913	0.139	0.114	Q5JSH3.pdb.gz	WDR44_HUMAN WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 PE=1 SV=1
20	AFDB:Q9H2Y7	0.333	0.137	1.651E-17	1883	0.110	0.044	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4D1P6	0.0	1558	747	1.000	1.000	WDR91_HUMAN WD repeat-containing protein 91 OS=Homo sapiens OX=9606 GN=WDR91 PE=1 SV=2
2	Q9VE12	4.95e-56	196	324	0.114	0.262	Q9VE12_DROME LD27322p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6005 PE=2 SV=2
3	Q23533	7.29e-23	100	239	0.071	0.222	SORF1_CAEEL Suppressor of organelle fusion 1 OS=Caenorhabditis elegans OX=6239 GN=sorf-1 PE=1 SV=3
4	A2CEH0	5.15e-09	61.6	490	0.074	0.112	POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio OX=7955 GN=poc1b PE=2 SV=1
5	Q9NHF0	1.29e-08	60.8	823	0.070	0.063	Q9NHF0_DROME Katanin p80 WD40 repeat-containing subunit B1 OS=Drosophila melanogaster OX=7227 GN=kat80 PE=2 SV=1
6	Q5RKI0	1.75e-08	60.1	606	0.119	0.147	WDR1_RAT WD repeat-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Wdr1 PE=1 SV=3
7	X2JKM9	2.26e-08	60.1	818	0.067	0.061	X2JKM9_DROME Katanin p80 WD40 repeat-containing subunit B1 OS=Drosophila melanogaster OX=7227 GN=kat80 PE=3 SV=1
8	Q0KHS0	2.28e-08	60.1	819	0.067	0.061	Q0KHS0_DROME Katanin p80 WD40 repeat-containing subunit B1 OS=Drosophila melanogaster OX=7227 GN=kat80 PE=2 SV=1
9	Q8NBT0	2.28e-08	59.3	407	0.092	0.170	POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens OX=9606 GN=POC1A PE=1 SV=2
10	Q8SXM2	2.32e-08	60.1	819	0.067	0.061	Q8SXM2_DROME Katanin p80 WD40 repeat-containing subunit B1 OS=Drosophila melanogaster OX=7227 GN=kat80 PE=2 SV=1
11	Q8TC44	3.46e-08	58.9	478	0.074	0.115	POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens OX=9606 GN=POC1B PE=1 SV=1
12	O22469	7.49e-08	57.8	424	0.072	0.127	MSI3_ARATH WD-40 repeat-containing protein MSI3 OS=Arabidopsis thaliana OX=3702 GN=MSI3 PE=1 SV=2
13	A0A0S2Z507	9.32e-08	57.8	636	0.078	0.091	A0A0S2Z507_HUMAN Beta-transducin repeat containing isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
14	Q9BVA0	1.14e-07	57.8	655	0.076	0.087	KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens OX=9606 GN=KATNB1 PE=1 SV=1
15	Q9Y297	1.15e-07	57.8	605	0.078	0.096	FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
16	A0A0G2JX20	1.23e-07	57.8	659	0.076	0.086	A0A0G2JX20_RAT Katanin p80 WD40 repeat-containing subunit B1 OS=Rattus norvegicus OX=10116 GN=Katnb1 PE=3 SV=2
17	Q4VFZ4	1.23e-07	57.8	655	0.076	0.087	Q4VFZ4_RAT Katanin p80 WD40 repeat-containing subunit B1 OS=Rattus norvegicus OX=10116 GN=Katnb1 PE=2 SV=1
18	Q8BG40	1.32e-07	57.4	658	0.076	0.087	KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus OX=10090 GN=Katnb1 PE=1 SV=1
19	B1WBN6	1.38e-07	57.4	640	0.076	0.089	B1WBN6_RAT Katnb1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Katnb1 PE=2 SV=1
20	P90916	1.38e-07	57.0	417	0.072	0.129	LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans OX=6239 GN=lin-53 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.00082	30.9	Anaphase-promoting complex subunit 4 WD40 domain
2	PF16529 Ge1_WD40	18	15.9	WD40 region of Ge1, enhancer of mRNA-decapping protein
3	PF13570 PQQ_3	6.8	18.6	PQQ-like domain
4	PF00400 WD40	2.4e-09	48.8	WD domain, G-beta repeat
5	PF10440 WIYLD	4.2e+02	12.2	Ubiquitin-binding WIYLD domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346466

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386609	0.969	WD repeat-containing protein 81
2	9606.ENSP00000355231	0.876	Beclin-1
3	9606.ENSP00000342336	0.751	Protein FAM180A
4	9606.ENSP00000349856	0.747	Protein PRRC2B
5	9606.ENSP00000397655	0.690	Ankyrin repeat and SOCS box protein 15
6	9606.ENSP00000220509	0.657	Vacuolar protein sorting-associated protein 18 homolog
7	9606.ENSP00000297282	0.615	Solute carrier family 13 member 4
8	9606.ENSP00000263549	0.602	poly(ADP-ribose) polymerase family member 12
9	9606.ENSP00000312017	0.598	Protein FAM57A
10	9606.ENSP00000300935	0.597	Ras-related protein Rab-8A
11	9606.ENSP00000265062	0.587	Ras-related protein Rab-7a
12	9606.ENSP00000296473	0.586	Vacuolar fusion protein MON1 homolog A
13	9606.ENSP00000380793	0.548	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
14	9606.ENSP00000360938	0.543	Sarcosine dehydrogenase, mitochondrial
15	9606.ENSP00000347581	0.542	Acylglycerol kinase, mitochondrial
16	9606.ENSP00000417142	0.528	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
17	9606.ENSP00000282041	0.527	Ectopic P granules protein 5 homolog
18	9606.ENSP00000317955	0.511	Early endosome antigen 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035014	1.000	phosphatidylinositol 3-kinase regulator activity
GO:0097159	0.389	organic cyclic compound binding
GO:1901363	0.388	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.987	regulation of biological process
GO:0046907	0.985	intracellular transport
GO:0050794	0.984	regulation of cellular process
GO:0016192	0.975	vesicle-mediated transport
GO:0016482	0.968	cytosolic transport
GO:0019222	0.961	regulation of metabolic process
GO:0031323	0.947	regulation of cellular metabolic process
GO:0060255	0.907	regulation of macromolecule metabolic process
GO:0080090	0.901	regulation of primary metabolic process
GO:0009894	0.899	regulation of catabolic process
GO:0051171	0.896	regulation of nitrogen compound metabolic process
GO:0043550	0.822	regulation of lipid kinase activity
GO:0043551	0.777	regulation of phosphatidylinositol 3-kinase activity
GO:0051246	0.614	regulation of protein metabolic process
GO:0042176	0.459	regulation of protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.999	membrane
GO:0012505	0.999	endomembrane system
GO:0005829	0.998	cytosol
GO:0031090	0.989	organelle membrane
GO:0031410	0.977	cytoplasmic vesicle
GO:0005770	0.973	late endosome
GO:0005769	0.925	early endosome
GO:0098588	0.924	bounding membrane of organelle
GO:0030659	0.924	cytoplasmic vesicle membrane
GO:0010008	0.885	endosome membrane
GO:0019898	0.737	extrinsic component of membrane
GO:0005634	0.701	nucleus
GO:0031901	0.679	early endosome membrane
GO:0031902	0.615	late endosome membrane
GO:0032991	0.592	protein-containing complex
GO:0031312	0.366	extrinsic component of organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]