StarFunc result for job id A4D1S0

User Input

>input (409 residues)
MEESWEAAPGGQAGAELPMEPVGSLVPTLEQPQVPAKVRQPEGPESSPSPAGAVEKAAGA
GLEPSSKKKPPSPRPGSPRVPPLSLGYGVCPEPPSPGPALVKLPRNGEAPGAEPAPSAWA
PMELQVDVRVKPVGAAGGSSTPSPRPSTRFLKVPVPESPAFSRHADPAHQLLLRAPSQGG
TWGRRSPLAAARTESGCDAEGRASPAEGSAGSPGSPTCCRCKELGLEKEDAALLPRAGLD
GDEKLPRAVTLTGLPMYVKSLYWALAFMAVLLAVSGVVIVVLASRAGARCQQCPPGWVLS
EEHCYYFSAEAQAWEASQAFCSAYHATLPLLSHTQDFLGRYPVSRHSWVGAWRGPQGWHW
IDEAPLPPQLLPEDGEDNLDINCGALEEGTLVAANCSTPRPWVCAKGTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7wz8A	0.315	0.634	2.786E-10	180	0.100	0.228	7wz8A.pdb.gz
2	PDB:1qddA	0.251	0.653	1.304E-7	144	0.056	0.160	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
3	PDB:7qsrA	0.230	0.076	1.773E-7	1335	0.064	0.019	7qsrA.pdb.gz
4	AFDB:Q61282	0.266	0.054	2.101E-7	2132	0.188	0.036	Q61282.pdb.gz	PGCA_MOUSE Aggrecan core protein OS=Mus musculus OX=10090 GN=Acan PE=1 SV=2
5	PDB:1gz2A	0.223	0.590	2.411E-7	139	0.064	0.187	1gz2A.pdb.gz
6	PDB:3bx4C	0.213	0.603	4.194E-7	134	0.076	0.231	3bx4C.pdb.gz
7	PDB:4mthA	0.238	0.626	5.363E-7	139	0.059	0.173	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
8	PDB:5f2qB	0.233	0.617	6.449E-7	135	0.059	0.178	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
9	AFDB:F1R511	0.252	0.089	1.503E-6	1207	0.159	0.054	F1R511.pdb.gz
10	PDB:7jptA	0.252	0.083	2.346E-6	1327	0.078	0.024	7jptA.pdb.gz
11	PDB:1bj3A	0.213	0.617	3.190E-6	129	0.071	0.225	1bj3A.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
12	PDB:2kv3A	0.244	0.671	3.392E-6	131	0.068	0.214	2kv3A.pdb.gz
13	AFDB:D3ZQU7	0.087	0.057	4.476E-1	717	0.166	0.095	D3ZQU7.pdb.gz	D3ZQU7_RAT Glycoprotein Ib platelet subunit alpha OS=Rattus norvegicus OX=10116 GN=Gp1ba PE=1 SV=1
14	AFDB:Q6DIC6	0.097	0.022	2.831	2087	0.105	0.021	Q6DIC6.pdb.gz	Q6DIC6_MOUSE Tro protein OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
15	AFDB:O75298	0.075	0.058	3.405	545	0.134	0.101	O75298.pdb.gz	RTN2_HUMAN Reticulon-2 OS=Homo sapiens OX=9606 GN=RTN2 PE=1 SV=1
16	AFDB:A0A024R9Y2	0.095	0.040	4.094	1105	0.100	0.037	A0A024R9Y2.pdb.gz
17	AFDB:F1QKS5	0.078	0.032	4.354	1289	0.152	0.048	F1QKS5.pdb.gz
18	AFDB:Q84TK1	0.103	0.094	4.630	458	0.152	0.135	Q84TK1.pdb.gz	BH010_ARATH Transcription factor bHLH10 OS=Arabidopsis thaliana OX=3702 GN=BHLH10 PE=1 SV=1
19	AFDB:M0QXN5	0.098	0.091	5.568	446	0.134	0.123	M0QXN5.pdb.gz	M0QXN5_HUMAN Nucleoporin 62 OS=Homo sapiens OX=9606 GN=NUP62 PE=1 SV=1
20	AFDB:Q7Z6L0	0.070	0.078	5.568	340	0.166	0.200	Q7Z6L0.pdb.gz	PRRT2_HUMAN Proline-rich transmembrane protein 2 OS=Homo sapiens OX=9606 GN=PRRT2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96E93	1.87e-14	73.6	195	0.098	0.205	KLRG1_HUMAN Killer cell lectin-like receptor subfamily G member 1 OS=Homo sapiens OX=9606 GN=KLRG1 PE=1 SV=1
2	Q92478	2.48e-14	72.0	149	0.100	0.275	CLC2B_HUMAN C-type lectin domain family 2 member B OS=Homo sapiens OX=9606 GN=CLEC2B PE=1 SV=2
3	Q9UHP7	6.18e-13	69.3	191	0.115	0.246	CLC2D_HUMAN C-type lectin domain family 2 member D OS=Homo sapiens OX=9606 GN=CLEC2D PE=1 SV=1
4	Q8C1T8	1.28e-11	65.9	218	0.086	0.161	CLC2H_MOUSE C-type lectin domain family 2 member H OS=Mus musculus OX=10090 GN=Clec2h PE=2 SV=1
5	Q91V08	2.79e-11	64.7	207	0.095	0.188	CLC2D_MOUSE C-type lectin domain family 2 member D OS=Mus musculus OX=10090 GN=Clec2d PE=1 SV=1
6	O88713	2.98e-11	64.3	188	0.090	0.197	KLRG1_MOUSE Killer cell lectin-like receptor subfamily G member 1 OS=Mus musculus OX=10090 GN=Klrg1 PE=1 SV=2
7	P26715	6.35e-11	64.3	233	0.095	0.167	NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC1 PE=1 SV=2
8	Q64335	7.76e-11	63.2	188	0.086	0.186	KLRG1_RAT Killer cell lectin-like receptor subfamily G member 1 OS=Rattus norvegicus OX=10116 GN=Klrg1 PE=1 SV=1
9	D3YXP2	7.52e-10	60.8	221	0.095	0.176	D3YXP2_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=4 SV=1
10	Q80ZC8	1.07e-09	60.5	226	0.100	0.181	KLRE1_RAT Killer cell lectin-like receptor subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Klre1 PE=1 SV=1
11	L7N477	1.17e-09	60.1	213	0.093	0.178	L7N477_MOUSE Killer cell lectin-like receptor subfamily C, member 3 OS=Mus musculus OX=10090 GN=Klrc3 PE=4 SV=1
12	Q9QXN7	1.40e-09	60.1	221	0.098	0.181	Q9QXN7_MOUSE Killer cell lectin-like receptor subfamily C, member 3 OS=Mus musculus OX=10090 GN=Klrc3 PE=2 SV=1
13	Q9D676	1.46e-09	60.8	269	0.083	0.126	CLC2G_MOUSE C-type lectin domain family 2 member G OS=Mus musculus OX=10090 GN=Clec2g PE=2 SV=1
14	P26717	1.65e-09	60.1	231	0.081	0.143	NKG2C_HUMAN NKG2-C type II integral membrane protein OS=Homo sapiens OX=9606 GN=KLRC2 PE=1 SV=3
15	Q9WTJ9	2.23e-09	59.7	238	0.086	0.147	Q9WTJ9_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=2 SV=1
16	Q9WVJ7	2.36e-09	59.3	213	0.086	0.164	Q9WVJ7_MOUSE Killer cell lectin-like receptor subfamily C, member 2 OS=Mus musculus OX=10090 GN=Klrc2 PE=2 SV=1
17	Q9WVJ8	2.83e-09	58.9	210	0.086	0.167	Q9WVJ8_MOUSE Natural killer cell protein group 2-A2 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
18	Q9Z202	3.53e-09	59.3	244	0.086	0.143	Q9Z202_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1
19	E9QAJ6	4.25e-09	58.5	210	0.086	0.167	E9QAJ6_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=4 SV=1
20	Q9WU32	4.41e-09	58.5	227	0.086	0.154	Q9WU32_MOUSE Killer cell lectin-like receptor subfamily C, member 1 OS=Mus musculus OX=10090 GN=Klrc1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00059 Lectin_C	0.00027	33.0	Lectin C-type domain
2	PF05473 UL45	98	14.0	UL45 protein, carbohydrate-binding C-type lectin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339356

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000289902	0.716	High affinity immunoglobulin epsilon receptor subunit gamma
2	9606.ENSP00000221466	0.675	IgG receptor FcRn large subunit p51
3	9606.ENSP00000418693	0.628	RWD domain containing 2B
4	9606.ENSP00000418648	0.606	Ubinuclein-2
5	9606.ENSP00000304071	0.566	Uncharacterized protein C7orf33
6	9606.ENSP00000435189	0.562	Ras-related protein Rab-30
7	9606.ENSP00000334808	0.544	Ubiquitin carboxyl-terminal hydrolase 16
8	9606.ENSP00000339477	0.530	Inducible T-cell co-stimulator ligand
9	9606.ENSP00000483732	0.530	ICOS ligand
10	9606.ENSP00000440222	0.512	Putative RNA-binding protein Luc7-like 2
11	9606.ENSP00000300961	0.511	Junctional sarcoplasmic reticulum protein 1
12	9606.ENSP00000297534	0.507	Protein FMC1 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030246	0.539	carbohydrate binding
GO:0042802	0.434	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.982	biological regulation
GO:0009987	0.956	cellular process
GO:0050789	0.896	regulation of biological process
GO:0050794	0.717	regulation of cellular process
GO:0050896	0.385	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043231	0.981	intracellular membrane-bounded organelle
GO:0005737	0.714	cytoplasm
GO:0012505	0.419	endomembrane system
GO:0005634	0.337	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]