StarFunc result for job id A4D2B8

User Input

>input (440 residues)
MVTMCGGHRPENFLHQVLTEFGEELAGEGKSEVGGGAPRSYLQVASAECWAAAPAVHVGE
PVHAGGLHTERGADPVIGLYLVHRGGACQTPTVGNRQTPTLGIHARPRRRATTSLLTLLL
AFGKNAVRCALIGPGSLTSRTRPLTEPLGEKERREVFFPPRPERVEHNVESSRWEPRRRG
ACGSRGGNFPSPRGGSGVASLERAESSSTEPAKAIKPIDRKSVHQICSGPVVPSLSTAVK
ELVENSLDAGATNIDLKLKDYGVDLIEVSGNGCGVEEENFEGLTLKHHTSKIQEFADLPQ
VETFGFRGEALSSLCALSDVTISTCHVSAKVGTRLVFDHYGKIIQKTPYPHPRGMTVSVK
QLFSTLPVHHKEFQRNIKKKRACFPFAFCRDCQFPEASPAMLPVQPAELTPRSTPPHPCS
LEDNVITVFSSVKNGPGSSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P54278	0.392	0.202	1.822E-24	862	0.382	0.195	P54278.pdb.gz	PMS2_HUMAN Mismatch repair endonuclease PMS2 OS=Homo sapiens OX=9606 GN=PMS2 PE=1 SV=2
2	AFDB:P54279	0.392	0.202	5.669E-23	859	0.341	0.175	P54279.pdb.gz	PMS2_MOUSE Mismatch repair endonuclease PMS2 OS=Mus musculus OX=10090 GN=Pms2 PE=2 SV=2
3	AFDB:F1NQJ3	0.441	0.230	3.072E-22	869	0.336	0.170	F1NQJ3.pdb.gz	PMS2_CHICK Mismatch repair endonuclease PMS2 OS=Gallus gallus OX=9031 GN=PMS2 PE=2 SV=3
4	AFDB:B1H246	0.394	0.205	4.896E-22	853	0.343	0.177	B1H246.pdb.gz	B1H246_RAT Pms2 protein OS=Rattus norvegicus OX=10116 GN=Pms2 PE=2 SV=1
5	AFDB:A0A669KB03	0.357	0.310	2.090E-15	512	0.139	0.119	A0A669KB03.pdb.gz	A0A669KB03_HUMAN MutL homolog 1 OS=Homo sapiens OX=9606 GN=MLH1 PE=1 SV=1
6	AFDB:Q9ZRV4	0.426	0.262	2.216E-15	737	0.168	0.100	Q9ZRV4.pdb.gz	MLH1_ARATH DNA mismatch repair protein MLH1 OS=Arabidopsis thaliana OX=3702 GN=MLH1 PE=2 SV=1
7	AFDB:Q9XU10	0.347	0.203	3.968E-15	758	0.139	0.080	Q9XU10.pdb.gz	Q9XU10_CAEEL DNA mismatch repair protein S5 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mlh-1 PE=1 SV=2
8	AFDB:B8A6F5	0.396	0.247	8.972E-15	725	0.152	0.092	B8A6F5.pdb.gz
9	AFDB:Q6P7D0	0.361	0.178	1.201E-14	919	0.143	0.069	Q6P7D0.pdb.gz	Q6P7D0_RAT PMS1 postmeiotic segregation increased 1 (S. cerevisiae) OS=Rattus norvegicus OX=10116 GN=Pms1 PE=2 SV=1
10	AFDB:P38920	0.341	0.198	2.150E-14	769	0.125	0.072	P38920.pdb.gz	MLH1_YEAST DNA mismatch repair protein MLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MLH1 PE=1 SV=2
11	PDB:7p8vA	0.334	0.440	4.884E-13	331	0.125	0.166	7p8vA.pdb.gz	MutL binds to 3' resected DNA ends and blocks DNA polymerase access.
12	PDB:5tthA	0.257	0.178	2.632E-6	671	0.070	0.046	5tthA.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
13	PDB:7kclB	0.250	0.187	5.952E-6	614	0.064	0.046	7kclB.pdb.gz	Cryo-EM reveals the dynamic interplay between mitochondrial Hsp90 and SdhB folding intermediates
14	PDB:5tthB	0.265	0.194	2.145E-5	621	0.068	0.048	5tthB.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
15	PDB:5fwkA	0.256	0.184	2.554E-5	638	0.061	0.042	5fwkA.pdb.gz	Atomic Structure of Hsp90-Cdc37-Cdk4 Reveals that Hsp90 Traps and Stabilizes an Unfolded Kinase.
16	PDB:6zy7B	0.277	0.118	4.849E-5	1160	0.075	0.028	6zy7B.pdb.gz	Structural basis for allosteric regulation of Human Topoisomerase II alpha.
17	PDB:6rkwD	0.251	0.151	5.140E-5	781	0.070	0.040	6rkwD.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.
18	PDB:2cg9B	0.250	0.186	7.292E-5	618	0.061	0.044	2cg9B.pdb.gz	Crystal Structure of an Hsp90-Nucleotide-P23/Sba1 Closed Chaperone Complex
19	PDB:1y4uB	0.189	0.184	1.232E-4	454	0.061	0.059	1y4uB.pdb.gz
20	PDB:2zbkB	0.220	0.193	2.479E-4	506	0.068	0.059	2zbkB.pdb.gz	Crystal Structure of an Intact Type II DNA Topoisomerase: Insights into DNA Transfer Mechanisms

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P54278	7.90e-108	340	862	0.382	0.195	PMS2_HUMAN Mismatch repair endonuclease PMS2 OS=Homo sapiens OX=9606 GN=PMS2 PE=1 SV=2
2	A0A8I5ZND0	1.27e-98	305	461	0.343	0.328	A0A8I5ZND0_RAT PMS1 homolog 2, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms2 PE=3 SV=1
3	P54279	2.69e-95	307	859	0.345	0.177	PMS2_MOUSE Mismatch repair endonuclease PMS2 OS=Mus musculus OX=10090 GN=Pms2 PE=2 SV=2
4	D4A360	1.01e-94	304	800	0.343	0.189	D4A360_RAT PMS1 homolog 2, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms2 PE=3 SV=2
5	B1H246	1.67e-94	305	853	0.343	0.177	B1H246_RAT Pms2 protein OS=Rattus norvegicus OX=10116 GN=Pms2 PE=2 SV=1
6	A0A0G2JW47	4.39e-94	304	882	0.343	0.171	A0A0G2JW47_RAT PMS1 homolog 2, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms2 PE=3 SV=1
7	F1NQJ3	1.20e-86	284	869	0.318	0.161	PMS2_CHICK Mismatch repair endonuclease PMS2 OS=Gallus gallus OX=9031 GN=PMS2 PE=2 SV=3
8	Q941I6	1.10e-52	192	923	0.207	0.099	PMS1_ARATH DNA mismatch repair protein PMS1 OS=Arabidopsis thaliana OX=3702 GN=PMS1 PE=1 SV=1
9	P54280	1.08e-45	171	794	0.191	0.106	PMS1_SCHPO DNA mismatch repair protein pms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pms1 PE=3 SV=1
10	P14242	9.04e-40	154	873	0.180	0.090	PMS1_YEAST DNA mismatch repair protein PMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMS1 PE=1 SV=3
11	G5EFG5	3.42e-38	149	805	0.161	0.088	G5EFG5_CAEEL Mismatch repair endonuclease PMS2 OS=Caenorhabditis elegans OX=6239 GN=pms-2 PE=1 SV=1
12	P54277	4.01e-30	125	932	0.152	0.072	PMS1_HUMAN PMS1 protein homolog 1 OS=Homo sapiens OX=9606 GN=PMS1 PE=1 SV=1
13	Q6P7D0	5.54e-29	122	919	0.139	0.066	Q6P7D0_RAT PMS1 postmeiotic segregation increased 1 (S. cerevisiae) OS=Rattus norvegicus OX=10116 GN=Pms1 PE=2 SV=1
14	D4A651	5.91e-29	122	919	0.139	0.066	D4A651_RAT PMS1 homolog 1, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms1 PE=3 SV=3
15	A0A8I6AGZ9	6.93e-29	122	880	0.139	0.069	A0A8I6AGZ9_RAT PMS1 homolog 1, mismatch repair system component OS=Rattus norvegicus OX=10116 GN=Pms1 PE=3 SV=1
16	E9Q8A5	7.53e-29	121	669	0.148	0.097	E9Q8A5_MOUSE PMS1 homolog 1, mismatch repair system component (Fragment) OS=Mus musculus OX=10090 GN=Pms1 PE=1 SV=1
17	Q3US89	7.74e-29	121	669	0.148	0.097	Q3US89_MOUSE HMG box domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Pms1 PE=2 SV=1
18	Q8K119	1.20e-28	121	917	0.148	0.071	Q8K119_MOUSE PMS1 homolog 1, mismatch repair system component OS=Mus musculus OX=10090 GN=Pms1 PE=1 SV=1
19	C9J167	4.83e-28	119	756	0.127	0.074	C9J167_HUMAN PMS1 homolog 2, mismatch repair system component OS=Homo sapiens OX=9606 GN=PMS2 PE=3 SV=2
20	D3Z0R7	7.03e-26	103	127	0.116	0.402	D3Z0R7_MOUSE PMS1 homolog 1, mismatch repair system component (Fragment) OS=Mus musculus OX=10090 GN=Pms1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02518 HATPase_c	3.7	19.5	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
2	PF13589 HATPase_c_3	4.1e-06	38.2	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000022894

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000022032	0.954	DNA mismatch repair protein
2	9593.ENSGGOP00000018924	0.949	MutS homolog 6
3	9593.ENSGGOP00000015949	0.879	mutL homolog 1
4	9593.ENSGGOP00000027966	0.876	Component of the post-replicative DNA mismatch repair system (MMR)
5	9593.ENSGGOP00000013234	0.862	Exonuclease 1
6	9593.ENSGGOP00000011057	0.788	DNA mismatch repair protein
7	9593.ENSGGOP00000001670	0.636	Proliferating cell nuclear antigen
8	9593.ENSGGOP00000017490	0.636	Proliferating cell nuclear antigen
9	9593.ENSGGOP00000018939	0.605	Polymerase (DNA directed), delta 1, catalytic subunit
10	9593.ENSGGOP00000009561	0.592	Cellular tumor antigen p53
11	9593.ENSGGOP00000008668	0.589	BRCA1 interacting protein C-terminal helicase 1
12	9593.ENSGGOP00000013754	0.567	ERCC excision repair 5, endonuclease
13	9593.ENSGGOP00000014730	0.536	Replication protein A subunit
14	9593.ENSGGOP00000009612	0.535	E3 ubiquitin-protein ligase that specifically mediates the formation of 'Lys-6'-linked polyubiquitin chains and plays a central role in DNA repair by facilitating cellular responses to DNA damage. It is unclear whether it also mediates the formation of other types of polyubiquitin chains. The E3 ubiquitin-protein ligase activity is required for its tumor suppressor function. The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Regulates centrosomal microtubule [...]
15	9593.ENSGGOP00000001911	0.526	Nuclease required for the repair of DNA interstrand cross- links (ICL). Acts as a 5'-3' exonuclease that anchors at a cut end of DNA and cleaves DNA successively at every third nucleotide, allowing to excise an ICL from one strand through flanking incisions.
16	9593.ENSGGOP00000012253	0.523	Flap endonuclease 1
17	9593.ENSGGOP00000027062	0.523	Flap endonuclease 1
18	9593.ENSGGOP00000021616	0.512	F-box protein, helicase, 18
19	9593.ENSGGOP00000017047	0.511	PMS1 homolog 1, mismatch repair system component
20	9593.ENSGGOP00000011864	0.508	GEN1 Holliday junction 5' flap endonuclease

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003677	0.998	DNA binding
GO:0003824	0.997	catalytic activity
GO:0016787	0.992	hydrolase activity
GO:0043167	0.953	ion binding
GO:0003690	0.651	double-stranded DNA binding
GO:0036094	0.572	small molecule binding
GO:0043168	0.566	anion binding
GO:0000166	0.562	nucleotide binding
GO:0035639	0.541	purine ribonucleoside triphosphate binding
GO:0097367	0.514	carbohydrate derivative binding
GO:0030983	0.514	mismatched DNA binding
GO:0017076	0.498	purine nucleotide binding
GO:0032555	0.492	purine ribonucleotide binding
GO:0032559	0.482	adenyl ribonucleotide binding
GO:0005524	0.471	ATP binding
GO:0004518	0.309	nuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.908	response to stimulus
GO:0071704	0.792	organic substance metabolic process
GO:0009987	0.743	cellular process
GO:0044238	0.429	primary metabolic process
GO:0044237	0.428	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.478	intracellular non-membrane-bounded organelle
GO:0005737	0.452	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.992	Hydrolases.
EC:3.1.-.-	0.309	Acting on ester bonds.

[back to server]