StarFunc result for job id A4D2P6

User Input

>input (1211 residues)
MATTATPATNQGWPEDFGFRLGGSGPCFVLEVAKGSSAHAGGLRPGDQILEVEGLAVGGL
SRERLVRLARRCPRVPPSLGVLPAPDGGPGPGSGPAAPTTVLRAPRCGRGLALGRELLRL
AGRKRPDAVHRERRRKAQEFSRKVDEILGDQPTAKEQVFAALKQFAAEQRVDDLVWTLTL
ALPREACGPLLDNLRIFIPKKHRARFDEVVSQGLLGKLCRARRAQGAQRLRRSRSEERPE
RLLVSTRASAPPRRPDEPPPRRASLLVGGLAGPGGARRTVRVYKGNKSFGFTLRGHGPVW
IESVLPGSPADNAALKSGDRILFLNGLDMRNCSHDKVVSMLQGSGAMPTLVVEEGLVPFA
SDSDSLDSPNPSSALTSLQWVAEILPSSIRVQGRTFSQQLEHLLTPPERYGVCRALESFF
QHRNIDTLIVDVYPVLDTPAKQVLWQFIYQLLTYEEQELCQEKIACFLGYTAMTAEPEPE
LDLESEPTPEPQPRSSLRASSMCRRSLRSQGLEAGLSCGPSECPEMPLPLIPGERQAGDG
TSLPETPNPKMMSAVYAELESRLNSSFKGKMGTVSKSRASPPGPSPAVTTGPRTLSGVSW
PSERLLPSPCYHPLCSGGLASPSSSESHPYASLDSSRAPSPQPGPGPICPDSPPSPDPTR
PPSRRKLFTFSHPVRSRDTDRFLDVLSEQLGPRVTIVDDFLTPENDYEEMSFHDDQGSFV
TNERSSASDCISSSEEGSSLTYSSISDHIPPPPLSPPPPPPLPFHDAKPSSRSSDGSRGP
AQALAKPLTQLSHPVPPPPPPPLPPPVPCAPPMLSRGLGHRRSETSHMSVKRLRWEQVEN
SEGTIWGQLGEDSDYDKLSDMVKYLDLELHFGTQKPAKPVPGPEPFRKKEVVEILSHKKA
YNTSILLAHLKLSPAELRQVLMSMEPRRLEPAHLAQLLLFAPDADEEQRYQAFREAPGRL
SEPDQFVLQMLSVPEYKTRLRSLHFQATLQEKTEEIRGSLECLRQASLELKNSRKLAKIL
EFVLAMGNYLNDGQPKTNKTTGFKINFLTELNSTKTVDGKSTFLHILAKSLSQHFPELLG
FAQDLPTVPLAAKVNQRALTSDLADLHGTISEIQDACQSISPSSEDKFAMVMSSFLETAQ
PALRALDGLQREAMEELGKALAFFGEDSKATTSEAFFGIFAEFMSKFERALSDLQAGEGL
RSSGMVSPLAW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0QWG9	0.416	0.418	0.000	1203	0.903	0.909	Q0QWG9.pdb.gz	GRD2I_MOUSE Delphilin OS=Mus musculus OX=10090 GN=Grid2ip PE=1 SV=1
2	AFDB:Q9NZ56	0.214	0.156	1.991E-17	1722	0.201	0.141	Q9NZ56.pdb.gz	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
3	AFDB:Q8I3F9	0.247	0.116	2.742E-11	2675	0.100	0.045	Q8I3F9.pdb.gz	Q8I3F9_PLAF7 Formin 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0530900 PE=4 SV=1
4	AFDB:E1JI78	0.242	0.120	1.281E-10	2528	0.128	0.061	E1JI78.pdb.gz	E1JI78_DROME Formin homology 2 domain containing, isoform I OS=Drosophila melanogaster OX=7227 GN=Fhos PE=4 SV=2
5	PDB:7qqnC	0.069	0.194	8.192E-5	414	0.035	0.101	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
6	AFDB:Q17353	0.076	0.068	2.863E-4	1379	0.097	0.085	Q17353.pdb.gz	PAR3_CAEEL Partitioning defective protein 3 OS=Caenorhabditis elegans OX=6239 GN=par-3 PE=1 SV=1
7	AFDB:D3YZU1	0.070	0.040	2.992E-4	2167	0.098	0.055	D3YZU1.pdb.gz	SHAN1_MOUSE SH3 and multiple ankyrin repeat domains protein 1 OS=Mus musculus OX=10090 GN=Shank1 PE=1 SV=1
8	PDB:7pe9I	0.069	0.259	4.178E-4	317	0.019	0.073	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
9	PDB:2xkxA	0.067	0.112	4.983E-4	721	0.045	0.075	2xkxA.pdb.gz
10	PDB:6t36A	0.065	0.810	5.442E-4	93	0.021	0.280	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
11	PDB:7pc3A	0.064	0.186	5.687E-4	405	0.023	0.069	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
12	PDB:7p70A	0.067	0.195	9.230E-4	407	0.030	0.088	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
13	PDB:7qqmA	0.066	0.189	9.646E-4	413	0.036	0.107	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
14	PDB:5n7dA	0.071	0.198	1.053E-3	423	0.029	0.083	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
15	PDB:7p73A	0.066	0.185	1.150E-3	420	0.020	0.057	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
16	PDB:7pcbA	0.065	0.188	1.202E-3	415	0.033	0.096	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	AFDB:Q8T2I8	0.044	0.045	1.742E-3	1167	0.077	0.080	Q8T2I8.pdb.gz	SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum OX=44689 GN=sepA PE=2 SV=1
18	AFDB:A0A0B4K6Y7	0.078	0.041	3.523E-3	2395	0.129	0.065	A0A0B4K6Y7.pdb.gz	A0A0B4K6Y7_DROME Polychaetoid, isoform O OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
19	AFDB:U3JAM7	0.059	0.061	3.682E-3	1184	0.122	0.125	U3JAM7.pdb.gz	U3JAM7_DANRE Synaptopodin 2-like b OS=Danio rerio OX=7955 GN=synpo2lb PE=4 SV=1
20	AFDB:Q6DFV3	0.066	0.042	4.021E-3	1944	0.088	0.055	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0QWG9	0.0	1956	1203	0.904	0.910	GRD2I_MOUSE Delphilin OS=Mus musculus OX=10090 GN=Grid2ip PE=1 SV=1
2	A0A0R4IER9	7.18e-45	179	1060	0.097	0.111	A0A0R4IER9_DANRE Disheveled-associated activator of morphogenesis 1 isoform X2 OS=Danio rerio OX=7955 GN=daam1a PE=4 SV=1
3	B3DJI0	1.91e-42	171	1069	0.094	0.107	B3DJI0_DANRE Daam1l protein OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
4	A0A1D5P556	2.11e-41	168	1075	0.096	0.108	DAAM2_CHICK Disheveled-associated activator of morphogenesis 2 OS=Gallus gallus OX=9031 GN=DAAM2 PE=1 SV=2
5	Q5RHJ3	9.56e-41	166	1079	0.093	0.105	Q5RHJ3_DANRE Disheveled-associated activator of morphogenesis 1 OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
6	Q8BPM0	1.33e-40	166	1077	0.095	0.107	DAAM1_MOUSE Disheveled-associated activator of morphogenesis 1 OS=Mus musculus OX=10090 GN=Daam1 PE=1 SV=4
7	Q86T65	2.75e-40	164	1068	0.097	0.110	DAAM2_HUMAN Disheveled-associated activator of morphogenesis 2 OS=Homo sapiens OX=9606 GN=DAAM2 PE=1 SV=3
8	Q9Y4D1	2.26e-39	161	1078	0.094	0.106	DAAM1_HUMAN Disheveled-associated activator of morphogenesis 1 OS=Homo sapiens OX=9606 GN=DAAM1 PE=1 SV=2
9	Q80U19	2.49e-38	158	1115	0.086	0.093	DAAM2_MOUSE Disheveled-associated activator of morphogenesis 2 OS=Mus musculus OX=10090 GN=Daam2 PE=1 SV=4
10	O60879	5.10e-38	157	1101	0.098	0.108	DIAP2_HUMAN Protein diaphanous homolog 2 OS=Homo sapiens OX=9606 GN=DIAPH2 PE=1 SV=1
11	M9MSM5	1.29e-37	156	1463	0.088	0.072	M9MSM5_DROME Dishevelled associated activator of morphogenesis, isoform D OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
12	Q8IRY0	3.95e-37	154	1153	0.088	0.092	Q8IRY0_DROME Dishevelled associated activator of morphogenesis, isoform B OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
13	Q7YZA4	5.48e-37	154	1114	0.088	0.095	Q7YZA4_DROME Dishevelled associated activator of morphogenesis, isoform A OS=Drosophila melanogaster OX=7227 GN=DAAM PE=1 SV=1
14	Q9NSV4	1.58e-36	152	1193	0.089	0.091	DIAP3_HUMAN Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3 PE=1 SV=4
15	O70566	1.69e-36	152	1098	0.097	0.107	DIAP2_MOUSE Protein diaphanous homolog 2 OS=Mus musculus OX=10090 GN=Diaph2 PE=1 SV=2
16	Q8MT16	5.32e-36	150	1114	0.087	0.094	Q8MT16_DROME RH61354p OS=Drosophila melanogaster OX=7227 GN=DAAM PE=2 SV=1
17	Q54WH2	3.52e-35	148	1218	0.088	0.087	FORA_DICDI Formin-A OS=Dictyostelium discoideum OX=44689 GN=forA PE=1 SV=1
18	P48608	4.54e-34	144	1091	0.096	0.106	DIA_DROME Protein diaphanous OS=Drosophila melanogaster OX=7227 GN=dia PE=2 SV=2
19	Q54N00	1.86e-33	142	1087	0.080	0.089	FORH_DICDI Formin-H OS=Dictyostelium discoideum OX=44689 GN=forH PE=1 SV=1
20	Q9W5A4	2.49e-33	142	979	0.088	0.108	Q9W5A4_DROME EG:114D9.2 protein OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02181 FH2	6.6e-93	323.4	Formin Homology 2 Domain
2	PF00595 PDZ	3.1e-19	80.4	PDZ domain
3	PF13180 PDZ_2	0.0017	30.0	PDZ domain
4	PF17820 PDZ_6	7.6e-11	53.1	PDZ domain
5	PF02163 Peptidase_M50	0.00069	30.6	Peptidase family M50
6	PF08585 RMI1_N	1.4e+02	13.7	RecQ mediated genome instability protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000397351

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000282020	0.986	Glutamate receptor ionotropic, delta-2
2	9606.ENSP00000413625	0.719	Formin-binding protein 1
3	9606.ENSP00000261187	0.706	Monocarboxylate transporter 2
4	9606.ENSP00000353590	0.690	Myosin-10
5	9606.ENSP00000225655	0.656	Profilin-1
6	9606.ENSP00000263773	0.655	Formin binding protein 4
7	9606.ENSP00000239940	0.652	Profilin-2
8	9606.ENSP00000329219	0.637	Formin-like protein 1
9	9606.ENSP00000333363	0.629	Dynein heavy chain 8, axonemal
10	9606.ENSP00000316845	0.624	Rho guanine nucleotide exchange factor 4
11	9606.ENSP00000384197	0.619	PDZ domain containing ring finger 4
12	9606.ENSP00000352926	0.597	Transcriptional enhancer factor TEF-3
13	9606.ENSP00000300571	0.592	G-protein coupled receptor family C group 5 member B
14	9606.ENSP00000426528	0.590	APC membrane recruitment protein 2
15	9606.ENSP00000340578	0.583	Ras association domain-containing protein 6
16	9606.ENSP00000258739	0.570	ER lumen protein-retaining receptor 2
17	9606.ENSP00000262753	0.569	Protein POF1B
18	9606.ENSP00000329647	0.559	Actin-like protein 10
19	9606.ENSP00000258787	0.545	Unconventional myosin-Ig
20	9606.ENSP00000368801	0.542	WW domain-binding protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.339	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0030029	0.944	actin filament-based process
GO:0071840	0.926	cellular component organization or biogenesis
GO:0016043	0.919	cellular component organization
GO:0007154	0.892	cell communication
GO:0050896	0.888	response to stimulus
GO:0051716	0.859	cellular response to stimulus
GO:0023052	0.836	signaling
GO:0023051	0.792	regulation of signaling
GO:0007165	0.760	signal transduction
GO:0006996	0.699	organelle organization
GO:0010646	0.653	regulation of cell communication
GO:0065008	0.539	regulation of biological quality
GO:0032501	0.492	multicellular organismal process
GO:0007010	0.489	cytoskeleton organization
GO:0030036	0.458	actin cytoskeleton organization
GO:0048519	0.376	negative regulation of biological process
GO:0048523	0.366	negative regulation of cellular process
GO:0042592	0.301	homeostatic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0030054	0.989	cell junction
GO:0005829	0.912	cytosol
GO:0045202	0.897	synapse
GO:0016020	0.861	membrane
GO:0043227	0.811	membrane-bounded organelle
GO:0043231	0.736	intracellular membrane-bounded organelle
GO:0005856	0.567	cytoskeleton
GO:0098978	0.447	glutamatergic synapse
GO:0071944	0.400	cell periphery
GO:0150048	0.378	cerebellar granule cell to Purkinje cell synapse
GO:0098794	0.362	postsynapse
GO:0099572	0.319	postsynaptic specialization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]