StarFunc result for job id A4FU69

User Input

>input (1503 residues)
MNESASQEELRPAQENRKEDKERKWNLTEVKELHETLQSVPDVPVKEDTNSVVEKAMDEI
KSQELNLEGQRKISPGSIKDSKTEASGNIAIRKSAKVIFALDETELKSKPEHTWKKNLFE
RMEARAQAMQQKIIDKENLKKELEKKAEKKLPRDNLAKEWFNTDSMTLNNTAYLLDKLLP
TLVPGVENMLTQVEKKKVLTEADTPSKFDPINYLGEYLIRNNPNYIKDPGMSGYQRLMKE
VTEDLKIYVPDTICNRVSKMKENVKQNRKQRESIDKIIVKVANTRKQALQEQFDEWILDP
KGMIPKSVIQNVLQEFFQNPDFKLGSHCKQLDITDSTEPRLNKMEFTEYISSHIKDLKSE
MFEELLKHLCHSADEFREVIKADMRRQMFAELFLHCDHGKVGFLDRQRTLALLELFYDHS
SQMLRSLLRNPRQWPFIEFEEINLTELWGDMDNQKHIYEGFDKVLLEMNTLLSANHASKT
QSKLLESPDQPKLNEQRTSTPSPNPPEQQRGVTAEQGPQRISIEEQQQGKKPTAEQELYI
ESVIEPGTHTESTLEQGSSRRLLTEQETHRESTTEQGQHKGSIEGQGPRRVSVSEQGSSR
ESVAEQGSRRESIAEQDRHKGSVAEQGSRRMSAAEQGSLRESVIEEPYQKSEQGPYGEII
SEEQEDIGSTSQSRKDSILKSTKYGEPITSEYIEVPLQEKRSWEQTYEEEIFLSSELQEE
VPTLSRKDHFPETTKKEVQKDKPCEPKSQKIEGKSWSGEFFTCNWKMKYVTFEDEEQANL
IYGNSRFTDLHSIIRNIQSCKEVKGRTAFNGVSFNLLQFVQLLETFVGEDAPLSVSETLT
SFFKEGYVETEQEKMNALEQFSQNAFQVRQRLLLEAIFQKWDSDGSGFLDLKEVDELLYT
YKEGMEKESMKKAKLHIQFPKPHPGHEVRLSSKQFQNYIELVVSELRGNEDQVLESVVEF
LMNALERSHIESLRNSARRKWLHQIQCAAETSGVSLEPVYSETFKALMQDAEAHGNKKIS
AHISLLEENLLLPEKGNVLLRNVACTLDDAQFVLNRVLYRDMKGISFTVVDEGKPIHVPQ
VQYHGNIFFWNQSRNKHDYNGSFLALPLQDAYMRIFGVLAVDTLRDPHEINIFLPHEIRF
YQGVANVFSTAYHYVHSREHILHIVITGIGWLYDVTSSITSITTYFVEPSPAQDSDYVLR
NMMVTGQLGLTEIHKNPPTIHRKSCIFRDFLFKCTDSSEVVLASACGETHIVVPLRERTG
EALGVLDFNIGQNRMLLCQEYKDLQKMMKVVQVACYEILGEFSGEIKKKYILEIENVREV
QRAGILFFRIMLLELQESIQLLNSMEFVSLLLYDHTLVTEPNSPQDSKSMELEANVKLVR
DILKAVILFFHPELEFSSDFGSWDKCKFYVNKYLVNNICAFDPTAKHVEVNVQLIDEYIR
DHSRTEVWKFGNVVIEHLYHWIHICSALMKITKQLNSGITPPLPSKTDNYMYAKMPGEGL
QEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6mzbB	0.107	0.186	8.387E-6	807	0.040	0.074	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
2	PDB:7jsnA	0.101	0.170	1.358E-5	820	0.051	0.093	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
3	PDB:1f5mB	0.093	0.660	2.942E-3	177	0.015	0.130	1f5mB.pdb.gz
4	PDB:1vhmB	0.088	0.703	2.676E-2	160	0.017	0.156	1vhmB.pdb.gz
5	AFDB:P08553	0.042	0.066	3.143E-2	848	0.084	0.149	P08553.pdb.gz	NFM_MOUSE Neurofilament medium polypeptide OS=Mus musculus OX=10090 GN=Nefm PE=1 SV=4
6	AFDB:E7ESP9	0.040	0.059	5.513E-2	877	0.089	0.153	E7ESP9.pdb.gz	E7ESP9_HUMAN Neurofilament medium chain OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=1
7	PDB:7rzwB	0.097	0.160	1.047E-1	864	0.022	0.038	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
8	PDB:2v50D	0.044	0.055	1.230E-1	998	0.033	0.050	2v50D.pdb.gz
9	AFDB:P23201	0.035	0.036	1.333E-1	1466	0.069	0.071	P23201.pdb.gz	SPA2_YEAST Protein SPA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPA2 PE=1 SV=1
10	PDB:2w1tA	0.069	0.505	1.387E-1	175	0.009	0.074	2w1tA.pdb.gz
11	AFDB:Q17602	0.050	0.053	1.766E-1	1390	0.059	0.063	Q17602.pdb.gz	NU214_CAEEL Nuclear pore complex protein 14 OS=Caenorhabditis elegans OX=6239 GN=npp-14 PE=1 SV=1
12	AFDB:P07197	0.050	0.063	2.073E-1	916	0.070	0.115	P07197.pdb.gz	NFM_HUMAN Neurofilament medium polypeptide OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=3
13	AFDB:P12036	0.044	0.060	2.246E-1	1026	0.073	0.107	P12036.pdb.gz	NFH_HUMAN Neurofilament heavy polypeptide OS=Homo sapiens OX=9606 GN=NEFH PE=1 SV=4
14	PDB:4zmuA	0.083	0.294	2.744E-1	341	0.023	0.103	4zmuA.pdb.gz
15	AFDB:Q9ULD4	0.046	0.054	2.858E-1	1205	0.071	0.088	Q9ULD4.pdb.gz	BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens OX=9606 GN=BRPF3 PE=1 SV=2
16	AFDB:P19246	0.048	0.059	2.975E-1	1090	0.067	0.092	P19246.pdb.gz	NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus OX=10090 GN=Nefh PE=1 SV=3
17	PDB:7stbH	0.037	0.103	3.096E-1	293	0.023	0.116	7stbH.pdb.gz	Mechanisms of loading and release of the 9-1-1 checkpoint clamp.
18	AFDB:Q6XZL8	0.036	0.036	3.785E-1	1540	0.061	0.060	Q6XZL8.pdb.gz	Q6XZL8_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Mus musculus OX=10090 GN=Dot1l PE=1 SV=1
19	PDB:5svcA	0.057	0.097	3.939E-1	763	0.018	0.035	5svcA.pdb.gz	Structural Basis for the Mechanism of ATP-Dependent Acetone Carboxylation.
20	AFDB:A8E7B7	0.040	0.049	3.940E-1	1122	0.073	0.097	A8E7B7.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IHN4	0.002	45.4	6093	0.023	0.006	Q8IHN4_PLAF7 Antigen 332, DBL-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1149000 PE=4 SV=2
2	P03027	0.031	41.2	524	0.018	0.052	NIFA_KLEPN Nif-specific regulatory protein OS=Klebsiella pneumoniae OX=573 GN=nifA PE=1 SV=1
3	P30667	0.24	38.5	625	0.017	0.040	NIFA_AZOBR Nif-specific regulatory protein OS=Azospirillum brasilense OX=192 GN=nifA PE=1 SV=1
4	Q96M32	1.2	36.2	723	0.019	0.039	KAD7_HUMAN Adenylate kinase 7 OS=Homo sapiens OX=9606 GN=AK7 PE=1 SV=3
5	Q9D2H2	1.2	36.2	614	0.021	0.050	KAD7_MOUSE Adenylate kinase 7 OS=Mus musculus OX=10090 GN=Ak7 PE=1 SV=1
6	Q9WVL5	2.0	35.4	950	0.010	0.016	MORC1_MOUSE MORC family CW-type zinc finger protein 1 OS=Mus musculus OX=10090 GN=Morc1 PE=2 SV=1
7	Q7Z6L0	2.4	34.7	340	0.029	0.126	PRRT2_HUMAN Proline-rich transmembrane protein 2 OS=Homo sapiens OX=9606 GN=PRRT2 PE=1 SV=1
8	A8J3A0	2.7	33.5	166	0.023	0.205	DRC8_CHLRE Dynein regulatory complex protein 8 OS=Chlamydomonas reinhardtii OX=3055 GN=DRC8 PE=1 SV=1
9	A0A1B0GTE9	4.7	33.9	287	0.029	0.150	A0A1B0GTE9_HUMAN Proline rich transmembrane protein 2 OS=Homo sapiens OX=9606 GN=PRRT2 PE=4 SV=1
10	A0A1B0GTP1	5.3	33.5	286	0.029	0.150	A0A1B0GTP1_HUMAN Proline rich transmembrane protein 2 OS=Homo sapiens OX=9606 GN=PRRT2 PE=4 SV=1
11	Q6PAL1	5.9	33.5	343	0.015	0.067	DRAXI_MOUSE Draxin OS=Mus musculus OX=10090 GN=Draxin PE=1 SV=2
12	F1M853	7.6	33.5	1453	0.021	0.022	F1M853_RAT Ribosome binding protein 1 OS=Rattus norvegicus OX=10116 GN=Rrbp1 PE=1 SV=3
13	Q03603	7.8	33.5	795	0.008	0.015	DGK3_CAEEL Probable diacylglycerol kinase 3 OS=Caenorhabditis elegans OX=6239 GN=dgk-3 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05186 Dpy-30	82	14.3	Dpy-30 motif
2	PF00036 EF-hand_1	2.6	18.9	EF hand
3	PF13202 EF-hand_5	3.6e+02	12.1	EF hand
4	PF13405 EF-hand_6	0.18	22.8	EF-hand domain
5	PF13499 EF-hand_7	6.1e+02	12.3	EF-hand domain pair

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378312

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247026	0.712	Nuclear speckle splicing regulatory protein 1
2	9606.ENSP00000269844	0.575	PR domain zinc finger protein 15
3	9606.ENSP00000386146	0.563	Uncharacterized protein C6orf226
4	9606.ENSP00000363259	0.506	Uncharacterized protein C10orf71

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.359	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.979	cellular process
GO:0007017	0.813	microtubule-based process
GO:0065007	0.644	biological regulation
GO:0050789	0.578	regulation of biological process
GO:0050794	0.572	regulation of cellular process
GO:0071840	0.472	cellular component organization or biogenesis
GO:0016043	0.400	cellular component organization
GO:0032501	0.363	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0043227	0.998	membrane-bounded organelle
GO:0005634	0.982	nucleus
GO:0031981	0.928	nuclear lumen
GO:0005654	0.793	nucleoplasm
GO:0005737	0.609	cytoplasm
GO:0071944	0.481	cell periphery
GO:0016020	0.352	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]