StarFunc result for job id A4GXA9

User Input

>input (379 residues)
MARVGPGRAGVSCQGRGRGRGGSGQRRPPTWEISDSDAEDSAGSEAAARARDPAGERRAA
AEALRLLRPEQVLKRLAVCVDTAILEDAGADVLMEALEALGCECRIEPQRPARSLRWTRA
SPDPCPRSLPPEVWAAGEQELLLLLEPEEFLQGVATLTQISGPTHWVPWISPETTARPHL
AVIGLDAYLWSRQHVSRGTQQPESPKVAGAEVAVSWPEVEEALVLLQLWANLDVLLVASW
QELSRHVCAVTKALAQYPLKQYRESQAFSFCTAGRWAAGEPVARDGAGLQAAWRRQIRQF
SRVSPAVADAVVTAFPSPRLLQQALEACSTERERMGLLADLPVPPSEGGRPRRVGPDLSR
RICLFLTTANPDLLLDLGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4GXA9	1.000	1.000	1.651E-72	379	1.000	1.000	A4GXA9.pdb.gz	EME2_HUMAN Probable crossover junction endonuclease EME2 OS=Homo sapiens OX=9606 GN=EME2 PE=1 SV=3
2	PDB:7f6lB	0.622	0.809	2.369E-43	282	0.741	0.996	7f6lB.pdb.gz
3	AFDB:Q8BJW7	0.693	0.472	1.432E-29	570	0.343	0.228	Q8BJW7.pdb.gz	EME1_MOUSE Crossover junction endonuclease EME1 OS=Mus musculus OX=10090 GN=Eme1 PE=1 SV=1
4	AFDB:Q96AY2	0.696	0.473	1.242E-28	570	0.348	0.232	Q96AY2.pdb.gz	EME1_HUMAN Crossover junction endonuclease EME1 OS=Homo sapiens OX=9606 GN=EME1 PE=1 SV=2
5	AFDB:Q84M98	0.605	0.432	1.505E-17	546	0.195	0.136	Q84M98.pdb.gz	EME1A_ARATH Crossover junction endonuclease EME1A OS=Arabidopsis thaliana OX=3702 GN=EME1A PE=1 SV=1
6	AFDB:C5H8J1	0.570	0.404	1.468E-16	551	0.216	0.149	C5H8J1.pdb.gz	EME1B_ARATH Crossover junction endonuclease EME1B OS=Arabidopsis thaliana OX=3702 GN=EME1B PE=1 SV=1
7	AFDB:Q0J9J6	0.578	0.356	3.736E-16	650	0.193	0.112	Q0J9J6.pdb.gz	EME1_ORYSJ Crossover junction endonuclease EME1 OS=Oryza sativa subsp. japonica OX=39947 GN=EME1 PE=2 SV=1
8	AFDB:Q9C103	0.545	0.302	8.749E-15	735	0.174	0.090	Q9C103.pdb.gz	EME1_SCHPO Crossover junction endonuclease eme1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eme1 PE=1 SV=2
9	AFDB:Q8IYD8	0.220	0.049	2.609E-4	2048	0.103	0.019	Q8IYD8.pdb.gz	FANCM_HUMAN Fanconi anemia group M protein OS=Homo sapiens OX=9606 GN=FANCM PE=1 SV=2
10	PDB:4bxoB	0.249	0.447	4.852E-4	196	0.090	0.173	4bxoB.pdb.gz	Architecture and DNA Recognition Elements of the Fanconi Anemia Fancm-Faap24 Complex.
11	PDB:6sxaG	0.304	0.502	1.654E-3	196	0.106	0.204	6sxaG.pdb.gz
12	PDB:6sxaF	0.236	0.130	1.354E-2	747	0.087	0.044	6sxaF.pdb.gz
13	PDB:6sxbF	0.230	0.134	1.813E-2	701	0.077	0.041	6sxbF.pdb.gz	Cryo-EM structures of the XPF-ERCC1 endonuclease reveal how DNA-junction engagement disrupts an auto-inhibited conformation.
14	AFDB:E9Q4S1	0.186	0.102	3.960E-2	865	0.082	0.036	E9Q4S1.pdb.gz	PDE8B_MOUSE High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B OS=Mus musculus OX=10090 GN=Pde8b PE=1 SV=1
15	PDB:7wq4A	0.226	0.323	7.806E-2	234	0.074	0.120	7wq4A.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
16	PDB:5mp9M	0.152	0.151	8.275E-2	381	0.082	0.081	5mp9M.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
17	PDB:5fkzE	0.154	0.096	9.860E-2	710	0.069	0.037	5fkzE.pdb.gz
18	PDB:7e1tB	0.187	0.334	9.860E-2	174	0.063	0.138	7e1tB.pdb.gz	Nde1 is a Rab9 effector for loading late endosomes to cytoplasmic dynein motor complex.
19	PDB:5el8A	0.102	0.160	1.245E-1	213	0.084	0.150	5el8A.pdb.gz
20	AFDB:H0YBQ0	0.092	0.062	1.517E-1	643	0.082	0.048	H0YBQ0.pdb.gz	H0YBQ0_HUMAN thioredoxin-disulfide reductase OS=Homo sapiens OX=9606 GN=TXNRD3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4GXA9	0.0	743	379	1.000	1.000	EME2_HUMAN Probable crossover junction endonuclease EME2 OS=Homo sapiens OX=9606 GN=EME2 PE=1 SV=3
2	Q8BJW7	2.46e-52	184	570	0.332	0.221	EME1_MOUSE Crossover junction endonuclease EME1 OS=Mus musculus OX=10090 GN=Eme1 PE=1 SV=1
3	Q96AY2	1.40e-48	174	570	0.340	0.226	EME1_HUMAN Crossover junction endonuclease EME1 OS=Homo sapiens OX=9606 GN=EME1 PE=1 SV=2
4	C5H8J1	4.07e-05	47.8	551	0.198	0.136	EME1B_ARATH Crossover junction endonuclease EME1B OS=Arabidopsis thaliana OX=3702 GN=EME1B PE=1 SV=1
5	Q84M98	4.55e-04	44.7	546	0.198	0.137	EME1A_ARATH Crossover junction endonuclease EME1A OS=Arabidopsis thaliana OX=3702 GN=EME1A PE=1 SV=1
6	Q0J9J6	0.001	43.1	650	0.156	0.091	EME1_ORYSJ Crossover junction endonuclease EME1 OS=Oryza sativa subsp. japonica OX=39947 GN=EME1 PE=2 SV=1
7	B3KX63	0.14	36.6	551	0.077	0.053	B3KX63_HUMAN Crossover junction endonuclease MUS81 OS=Homo sapiens OX=9606 GN=MUS81 PE=1 SV=1
8	Q96NY9	0.14	36.6	551	0.077	0.053	MUS81_HUMAN Crossover junction endonuclease MUS81 OS=Homo sapiens OX=9606 GN=MUS81 PE=1 SV=3
9	Q6NWY5	7.5	31.2	563	0.066	0.044	Q6NWY5_DANRE Ankyrin repeat and SOCS box-containing protein 2 OS=Danio rerio OX=7955 GN=zgc:77223 PE=2 SV=1
10	Q9V3T1	9.9	30.8	426	0.055	0.049	Q9V3T1_DROME Crossover junction endonuclease MUS81 OS=Drosophila melanogaster OX=7227 GN=mus81 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02732 ERCC4	3.8e-07	41.9	ERCC4 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000457353

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307853	0.998	Crossover junction endonuclease MUS81
2	9606.ENSP00000259008	0.959	Fanconi anemia group J protein
3	9606.ENSP00000355506	0.957	Exonuclease 1
4	9606.ENSP00000298139	0.946	Werner syndrome ATP-dependent helicase
5	9606.ENSP00000351185	0.945	DNA replication ATP-dependent helicase/nuclease DNA2
6	9606.ENSP00000310356	0.941	RecQ-mediated genome instability protein 2
7	9606.ENSP00000261584	0.939	Partner and localizer of BRCA2
8	9606.ENSP00000317039	0.934	RecQ-mediated genome instability protein 1
9	9606.ENSP00000369497	0.929	Breast cancer type 2 susceptibility protein
10	9606.ENSP00000325863	0.924	Double-strand break repair protein MRE11
11	9606.ENSP00000382628	0.923	DNA endonuclease RBBP8
12	9606.ENSP00000466121	0.923	Fanconi anemia core complex-associated protein 24
13	9606.ENSP00000336701	0.922	DNA repair protein RAD51 homolog 3
14	9606.ENSP00000340330	0.922	Histone acetyltransferase KAT5
15	9606.ENSP00000372088	0.921	DNA repair protein RAD51 homolog 1
16	9606.ENSP00000418960	0.921	Breast cancer type 1 susceptibility protein
17	9606.ENSP00000278616	0.920	Serine-protein kinase ATM
18	9606.ENSP00000347232	0.918	Bloom syndrome protein
19	9606.ENSP00000419471	0.918	DNA repair protein RAD51 homolog 2
20	9606.ENSP00000343526	0.917	Ubiquitin carboxyl-terminal hydrolase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016787	0.525	hydrolase activity
GO:0004518	0.516	nuclease activity
GO:0004519	0.505	endonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0044238	0.998	primary metabolic process
GO:0043170	0.997	macromolecule metabolic process
GO:0034641	0.995	cellular nitrogen compound metabolic process
GO:0090304	0.993	nucleic acid metabolic process
GO:0044260	0.992	cellular macromolecule metabolic process
GO:0033554	0.989	cellular response to stress
GO:0031297	0.979	replication fork processing
GO:0006302	0.977	double-strand break repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1905348	0.996	endonuclease complex
GO:1905347	0.993	endodeoxyribonuclease complex
GO:0005654	0.979	nucleoplasm
GO:0043232	0.586	intracellular non-membrane-bounded organelle
GO:0005737	0.489	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.525	Hydrolases.
EC:3.1.-.-	0.519	Acting on ester bonds.

[back to server]