StarFunc result for job id A5A3E0

User Input

>input (1075 residues)
MVVEVDSMPAASSVKKPFGLRSKMGKWCCRCFPCCRESGKSNVGTSGDHDDSAMKTLRSK
MGKWCRHCFPCCRGSGKSNVGASGDHDDSAMKTLRNKMGKWCCHCFPCCRGSSKSKVGAW
GDYDDSAFMEPRYHVRGEDLDKLHRAAWWGKVPRKDLIVMLRDTDVNKQDKQKRTALHLA
SANGNSEVVKLLLDRRCQLNVLDNKKRTALIKAVQCQEDECALMLLEHGTDPNIPDEYGN
TTLHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLLLGVHEQKQQVVKFLIKKKANLNA
LDRYGRTALILAVCCGSASIVSLLLEQNIDVSSQDLSGQTAREYAVSSHHHVICQLLSDY
KEKQMLKISSENSNPEQDLKLTSEEESQRFKGSENSQPEKMSQEPEINKDGDREVEEEMK
KHESNNVGLLENLTNGVTAGNGDNGLIPQRKSRTPENQQFPDNESEEYHRICELLSDYKE
KQMPKYSSENSNPEQDLKLTSEEESQRLKGSENGQPEKRSQEPEINKDGDRELENFMAIE
EMKKHRSTHVGFPENLTNGATAGNGDDGLIPPRKSRTPESQQFPDTENEEYHSDEQNDTQ
KQFCEEQNTGILHDEILIHEEKQIEVVEKMNSELSLSCKKEKDILHENSTLREEIAMLRL
ELDTMKHQSQLREKKYLEDIESVKKRNDNLLKALQLNELTMDDDTAVLVIDNGSGMCKAG
FAGDDAPRAVFPSIVGRPRQQGMMGGMHQKESYVGKEAQSKRGILTLKYPMEHGIITNWD
DMEKIWHHTFYNELRVAPEEHPVLLTEATLNPKANREKMTQIMFETFNTPAMYVAIQAVL
SLYTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELPDYLMKILTEHGYRF
TTMAEREIVRDIKEKLCYVALDFEQEMATVASSSSLEKSYELPDGQVITIGNERFRCPEA
LFQPCFLGMESCGIHETTFNSIMKSDVDIRKDLYTNTVLSGGTTMYPGMAHRMQKEIAAL
APSMMKIRIIAPPKRKYSVWVGGSILASLSTFQQMWISKQEYDESGPSIVHRKCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A5A3E0	1.000	1.000	0.000	1075	1.000	1.000	A5A3E0.pdb.gz	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2
2	AFDB:P07829	0.348	0.992	9.178E-59	376	0.297	0.848	P07829.pdb.gz	ACT3_DICDI Actin-3 OS=Dictyostelium discoideum OX=44689 GN=act3 PE=3 SV=3
3	AFDB:B6VNT8	0.347	0.988	1.473E-58	377	0.302	0.862	B6VNT8.pdb.gz	B6VNT8_PIG Actin alpha cardiac muscle 1 OS=Sus scrofa OX=9823 GN=ACTC1 PE=1 SV=1
4	AFDB:Q562R1	0.348	0.991	9.780E-58	376	0.292	0.835	Q562R1.pdb.gz	ACTBL_HUMAN Beta-actin-like protein 2 OS=Homo sapiens OX=9606 GN=ACTBL2 PE=1 SV=2
5	AFDB:P10989	0.348	0.993	8.624E-57	375	0.292	0.837	P10989.pdb.gz	ACT_SCHPO Actin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=act1 PE=1 SV=1
6	AFDB:P0CJ46	0.348	0.989	1.042E-56	377	0.285	0.812	P0CJ46.pdb.gz	ACT1_ARATH Actin-1 OS=Arabidopsis thaliana OX=3702 GN=ACT1 PE=1 SV=1
7	AFDB:A0JP26	0.305	0.541	6.002E-56	581	0.468	0.866	A0JP26.pdb.gz	POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens OX=9606 GN=POTEB3 PE=1 SV=2
8	AFDB:A0A1D8PFR4	0.347	0.990	1.059E-55	376	0.279	0.798	A0A1D8PFR4.pdb.gz	A0A1D8PFR4_CANAL Actin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ACT1 PE=3 SV=1
9	AFDB:P07828	0.346	0.974	5.549E-55	380	0.272	0.768	P07828.pdb.gz	ACT18_DICDI Actin-18 OS=Dictyostelium discoideum OX=44689 GN=act18 PE=3 SV=3
10	PDB:1c0gA	0.337	0.978	6.619E-55	368	0.298	0.870	1c0gA.pdb.gz	Structural basis for the higher Ca(2+)-activation of the regulated actin-activated myosin ATPase observed with Dictyostelium/Tetrahymena actin chimeras.
11	AFDB:P86287	0.348	0.990	7.031E-55	376	0.267	0.763	P86287.pdb.gz	ACT1_PLAFX Actin-1 OS=Plasmodium falciparum (isolate HB3) OX=137071 GN=ACT1 PE=1 SV=1
12	PDB:1yagA	0.343	0.982	1.965E-54	372	0.287	0.828	1yagA.pdb.gz	The structure of nonvertebrate actin: Implications for the ATP hydrolytic mechanism
13	PDB:6tu4A	0.340	0.960	2.873E-51	372	0.267	0.772	6tu4A.pdb.gz	High-resolution structures of malaria parasite actomyosin and actin filaments.
14	PDB:4cbxA	0.329	0.983	2.100E-47	358	0.238	0.715	4cbxA.pdb.gz	Structural Differences Explain Diverse Functions of Plasmodium Actins.
15	PDB:4pl7A	0.320	0.894	5.409E-47	382	0.258	0.725	4pl7A.pdb.gz	Structural basis of thymosin-beta 4/profilin exchange leading to actin filament polymerization.
16	PDB:4a7fA	0.334	0.919	7.079E-45	375	0.300	0.861	4a7fA.pdb.gz	Structure of the Rigor Actin-Tropomyosin-Myosin Complex.
17	PDB:6ltjK	0.291	0.972	1.021E-36	317	0.273	0.927	6ltjK.pdb.gz	Structure of nucleosome-bound human BAF complex.
18	PDB:7nvmK	0.265	0.838	2.758E-36	317	0.270	0.915	7nvmK.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
19	PDB:5kg8B	0.284	0.946	1.106E-34	313	0.254	0.872	5kg8B.pdb.gz
20	PDB:6w18B	0.315	0.895	1.359E-30	367	0.158	0.463	6w18B.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PFR4	655	376	0.279	0.798	A0A1D8PFR4_CANAL Actin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ACT1 PE=3 SV=1
2	A0JP26	886	581	0.402	0.744	POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens OX=9606 GN=POTEB3 PE=1 SV=2
3	A5A3E0	2254	1075	1.000	1.000	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2
4	B6VNT8	694	377	0.302	0.862	B6VNT8_PIG Actin alpha cardiac muscle 1 OS=Sus scrofa OX=9823 GN=ACTC1 PE=1 SV=1
5	F1P476	694	377	0.301	0.859	F1P476_CHICK Actin, alpha 2, smooth muscle, aorta OS=Gallus gallus OX=9031 GN=ACTA2 PE=3 SV=2
6	F1RCB6	683	377	0.296	0.844	F1RCB6_DANRE Actin alpha cardiac muscle 1a OS=Danio rerio OX=7955 GN=zgc:86725 PE=1 SV=1
7	G1NS52	723	376	0.315	0.902	G1NS52_MELGA Uncharacterized protein OS=Meleagris gallopavo OX=9103 GN=LOC100542800 PE=3 SV=1
8	G3CKA6	706	376	0.306	0.875	G3CKA6_SPOFR Actin OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
9	O45815	665	375	0.298	0.853	O45815_CAEEL Actin OS=Caenorhabditis elegans OX=6239 GN=act-5 PE=1 SV=1
10	P02572	716	376	0.311	0.888	ACT2_DROME Actin-42A OS=Drosophila melanogaster OX=7227 GN=Act42A PE=1 SV=3
11	P07828	633	380	0.272	0.768	ACT18_DICDI Actin-18 OS=Dictyostelium discoideum OX=44689 GN=act18 PE=3 SV=3
12	P07829	688	376	0.297	0.848	ACT3_DICDI Actin-3 OS=Dictyostelium discoideum OX=44689 GN=act3 PE=3 SV=3
13	P07830	696	376	0.303	0.867	ACT1_DICDI Major actin OS=Dictyostelium discoideum OX=44689 GN=act1 PE=1 SV=2
14	P08023	692	377	0.300	0.857	ACTA_CHICK Actin, aortic smooth muscle OS=Gallus gallus OX=9031 GN=ACTA2 PE=3 SV=2
15	P0CG38	2172	1075	0.967	0.967	POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens OX=9606 GN=POTEI PE=3 SV=1
16	P0CG39	2084	1038	0.935	0.968	POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens OX=9606 GN=POTEJ PE=3 SV=1
17	P0CJ46	662	377	0.285	0.812	ACT1_ARATH Actin-1 OS=Arabidopsis thaliana OX=3702 GN=ACT1 PE=1 SV=1
18	P0CJ47	662	377	0.285	0.812	ACT3_ARATH Actin-3 OS=Arabidopsis thaliana OX=3702 GN=ACT3 PE=1 SV=1
19	P0DM41	716	376	0.310	0.886	ACT1_CAEEL Actin-1 OS=Caenorhabditis elegans OX=6239 GN=act-1 PE=1 SV=1
20	P0DM42	716	376	0.310	0.886	ACT3_CAEEL Actin-3 OS=Caenorhabditis elegans OX=6239 GN=act-3 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00022 Actin	1.2e-137	470.3	Actin
2	PF00023 Ank	4.9e-22	88.6	Ankyrin repeat
3	PF12796 Ank_2	8.5e-31	117.7	Ankyrin repeats (3 copies)
4	PF13606 Ank_3	3.5e-15	65.4	Ankyrin repeat
5	PF13637 Ank_4	6.1e-24	95.4	Ankyrin repeats (many copies)
6	PF13857 Ank_5	1.7e-24	96.8	Ankyrin repeats (many copies)
7	PF14915 CCDC144C	7e-10	50.1	CCDC144C protein coiled-coil region
8	PF18579 Raf1_HTH	4.2e+02	12.0	Rubisco accumulation factor 1 helix turn helix domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350052

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229239	0.906	Glyceraldehyde-3-phosphate dehydrogenase
2	9606.ENSP00000452780	0.802	Beta-2-microglobulin
3	9606.ENSP00000348128	0.782	Supervillin
4	9606.ENSP00000449328	0.781	60S acidic ribosomal protein P0
5	9606.ENSP00000362413	0.770	Phosphoglycerate kinase 1
6	9606.ENSP00000375942	0.761	TATA-box-binding protein
7	9606.ENSP00000226207	0.755	Myosin-1
8	9606.ENSP00000360609	0.753	Heat shock protein HSP 90-beta
9	9606.ENSP00000375730	0.752	60S ribosomal protein L13a
10	9606.ENSP00000298556	0.742	Hypoxanthine-guanine phosphoribosyltransferase
11	9606.ENSP00000302728	0.740	Beta-glucuronidase
12	9606.ENSP00000339063	0.731	Elongation factor 1-alpha 1
13	9606.ENSP00000376297	0.727	Dynein light chain 1, cytoplasmic
14	9606.ENSP00000288235	0.723	Unconventional myosin-Ie
15	9606.ENSP00000352834	0.723	Unconventional myosin-Ic
16	9606.ENSP00000379287	0.723	14-3-3 protein zeta/delta
17	9606.ENSP00000264932	0.696	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
18	9606.ENSP00000295897	0.695	Serum albumin
19	9606.ENSP00000278715	0.692	Porphobilinogen deaminase
20	9606.ENSP00000369703	0.676	Tubulin beta-2A chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0001895	0.995	retina homeostasis
GO:0009987	0.436	cellular process
GO:0050789	0.362	regulation of biological process
GO:0050794	0.344	regulation of cellular process
GO:0032502	0.334	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070062	0.999	extracellular exosome
GO:0043229	0.645	intracellular organelle
GO:0005737	0.397	cytoplasm
GO:0043231	0.345	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]