StarFunc result for job id A5PKW4

User Input

>input (1024 residues)
MAQGAMRFCSEGDCAISPPRCPRRWLPEGPVPQSPPASMYGSTGSLLRRVAGPGPRGREL
GRVTAPCTPLRGPPSPRVAPSPWAPSSPTGQPPPGAQSSVVIFRFVEKASVRPLNGLPAP
GGLSRSWDLGGVSPPRPTPALGPGSNRKLRLEASTSDPLPARGGSALPGSRNLVHGPPAP
PQVGADGLYSSLPNGLGGPPERLATLFGGPADTGFLNQGDTWSSPREVSSHAQRIARAKW
EFFYGSLDPPSSGAKPPEQAPPSPPGVGSRQGSGVAVGRAAKYSETDLDTVPLRCYRETD
IDEVLAEREEADSAIESQPSSEGPPGTAYPPAPRPGPLPGPHPSLGSGNEDEDDDEAGGE
EDVDDEVFEASEGARPGSRMPLKSPVPFLPGTSPSADGPDSFSCVFEAILESHRAKGTSY
TSLASLEALASPGPTQSPFFTFELPPQPPAPRPDPPAPAPLAPLEPDSGTSSAADGPWTQ
RGEEEEAEARAKLAPGREPPSPCHSEDSLGLGAAPLGSEPPLSQLVSDSDSELDSTERLA
LGSTDTLSNGQKADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVF
TGMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPEALSSEDGAHTLTCALMLL
NTDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALYSSIKNEKLQWAIDEEELRRS
LSELADPNPKVIKRISGGSGSGSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRGK
RGWKSFHGILKGMILYLQKEEYKPGKALSETELKNAISIHHALATRASDYSKRPHVFYLR
TADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPAAVSSQKKFSRPLLPSAATRLSQ
EEQVRTHEAKLKAMASELREHRAAQLGKKGRGKEAEEQRQKEAYLEFEKSRYSTYAALLR
VKLKAGSEELDAVEAALAQAGSTEDGLPPSHSSPSLQPKPSSQPRAQRHSSEPRPGAGSG
RRKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A5PKW4	0.999	0.999	0.000	1024	1.000	1.000	A5PKW4.pdb.gz	PSD1_HUMAN PH and SEC7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PSD PE=1 SV=2
2	AFDB:Q8NDX1	0.393	0.382	3.063E-47	1056	0.350	0.339	Q8NDX1.pdb.gz	PSD4_HUMAN PH and SEC7 domain-containing protein 4 OS=Homo sapiens OX=9606 GN=PSD4 PE=1 SV=2
3	PDB:6bbpA	0.152	0.294	1.726E-17	520	0.086	0.169	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
4	PDB:6u3eA	0.149	0.376	1.267E-16	397	0.089	0.229	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
5	AFDB:P91620	0.142	0.078	1.009E-9	2061	0.149	0.074	P91620.pdb.gz	SIF2_DROME Protein still life, isoforms C/SIF type 2 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
6	AFDB:P97433	0.102	0.067	1.281E-6	1693	0.146	0.089	P97433.pdb.gz	ARG28_MOUSE Rho guanine nucleotide exchange factor 28 OS=Mus musculus OX=10090 GN=Arhgef28 PE=1 SV=2
7	AFDB:Q9VGI1	0.095	0.073	7.022E-6	1354	0.139	0.105	Q9VGI1.pdb.gz	Q9VGI1_DROME FI23955p1 OS=Drosophila melanogaster OX=7227 GN=prd1 PE=2 SV=1
8	AFDB:Q6ZNL6	0.089	0.065	9.401E-6	1462	0.157	0.110	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
9	AFDB:Q54DW4	0.089	0.071	2.486E-5	1350	0.148	0.113	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
10	PDB:7rx9A	0.078	0.169	9.294E-5	432	0.045	0.106	7rx9A.pdb.gz
11	PDB:6hhgA	0.086	0.214	2.341E-4	386	0.024	0.065	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
12	AFDB:E9Q7D5	0.088	0.060	3.603E-4	1581	0.160	0.104	E9Q7D5.pdb.gz	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
13	AFDB:Q8K4S1	0.075	0.043	4.376E-4	2282	0.130	0.058	Q8K4S1.pdb.gz	PLCE1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 OS=Mus musculus OX=10090 GN=Plce1 PE=1 SV=3
14	PDB:4mt6A	0.087	0.211	5.349E-4	389	0.039	0.103	4mt6A.pdb.gz
15	AFDB:M9PC26	0.103	0.056	5.858E-4	2021	0.146	0.074	M9PC26.pdb.gz	M9PC26_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=CG10020 PE=1 SV=1
16	PDB:3ljuX	0.090	0.225	7.161E-4	373	0.027	0.075	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
17	PDB:6s9wA	0.085	0.198	1.347E-3	411	0.024	0.061	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
18	PDB:4gouA	0.093	0.176	1.485E-3	507	0.036	0.073	4gouA.pdb.gz
19	PDB:4mk0A	0.084	0.131	2.534E-3	631	0.035	0.057	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:4uudC	0.079	0.557	2.372E-2	113	0.019	0.168	4uudC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IAG2	0.0	636	837	0.329	0.403	A0A0R4IAG2_DANRE PH and SEC7 domain-containing protein 2 isoform X2 OS=Danio rerio OX=7955 GN=psd2 PE=4 SV=1
2	A5PKW4	0.0	2048	1024	1.000	1.000	PSD1_HUMAN PH and SEC7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PSD PE=1 SV=2
3	Q2PFD7	0.0	610	1037	0.289	0.285	PSD3_MOUSE PH and SEC7 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Psd3 PE=1 SV=2
4	Q5DTT2	0.0	1781	1024	0.922	0.922	PSD1_MOUSE PH and SEC7 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Psd PE=1 SV=2
5	Q6P1I6	0.0	625	770	0.333	0.443	PSD2_MOUSE PH and SEC7 domain-containing protein 2 OS=Mus musculus OX=10090 GN=Psd2 PE=1 SV=1
6	Q9ESQ7	0.0	1158	649	0.592	0.934	PSD1_RAT PH and SEC7 domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Psd PE=1 SV=1
7	Q8NDX1	3.35e-146	465	1056	0.243	0.236	PSD4_HUMAN PH and SEC7 domain-containing protein 4 OS=Homo sapiens OX=9606 GN=PSD4 PE=1 SV=2
8	E1JIT7	4.47e-126	422	1601	0.212	0.136	PSD_DROME PH and SEC7 domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Efa6 PE=1 SV=2
9	G5EET6	8.83e-70	251	818	0.161	0.202	EFA6_CAEEL Exchange factor for Arf-6 OS=Caenorhabditis elegans OX=6239 GN=efa-6 PE=1 SV=1
10	Q6PW01	2.09e-29	124	398	0.064	0.166	Q6PW01_DANRE Cytohesin 1-like protein OS=Danio rerio OX=7955 GN=cyth1 PE=2 SV=1
11	P97694	2.32e-28	120	398	0.060	0.153	CYH1_RAT Cytohesin-1 OS=Rattus norvegicus OX=10116 GN=Cyth1 PE=1 SV=1
12	Q9QX11	2.32e-28	120	398	0.060	0.153	CYH1_MOUSE Cytohesin-1 OS=Mus musculus OX=10090 GN=Cyth1 PE=1 SV=2
13	Q15438	6.33e-28	119	398	0.062	0.161	CYH1_HUMAN Cytohesin-1 OS=Homo sapiens OX=9606 GN=CYTH1 PE=1 SV=1
14	O08967	1.35e-27	118	399	0.058	0.148	CYH3_MOUSE Cytohesin-3 OS=Mus musculus OX=10090 GN=Cyth3 PE=1 SV=1
15	Q6PC26	1.77e-27	118	399	0.058	0.148	Q6PC26_DANRE Cytohesin-1 OS=Danio rerio OX=7955 GN=zgc:73134 PE=2 SV=1
16	O43739	5.01e-27	117	400	0.057	0.145	CYH3_HUMAN Cytohesin-3 OS=Homo sapiens OX=9606 GN=CYTH3 PE=1 SV=2
17	Q9V9Q6	1.77e-26	115	410	0.057	0.141	Q9V9Q6_DROME AT16263p OS=Drosophila melanogaster OX=7227 GN=step PE=2 SV=2
18	Q0E8N2	2.50e-26	118	727	0.057	0.080	Q0E8N2_DROME MIP16918p OS=Drosophila melanogaster OX=7227 GN=step PE=2 SV=2
19	X1WHH8	6.15e-26	112	351	0.056	0.162	X1WHH8_DANRE Cytohesin 1a OS=Danio rerio OX=7955 GN=cyth3b PE=4 SV=1
20	A0A2R8QK04	1.16e-25	112	396	0.056	0.144	A0A2R8QK04_DANRE Cytohesin 1a OS=Danio rerio OX=7955 GN=cyth3b PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	1.6e-08	46.4	PH domain
2	PF15410 PH_9	1.8e-28	110.6	Pleckstrin homology domain
3	PF01369 Sec7	1.2e-38	144.1	Sec7 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000020673

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298316	0.997	ADP-ribosylation factor 6
2	9606.ENSP00000355580	0.862	Potassium channel subfamily K member 1
3	9606.ENSP00000371586	0.795	Phosphatidylserine decarboxylase proenzyme, mitochondrial
4	9606.ENSP00000377941	0.758	Alpha-actinin-1
5	9606.ENSP00000402394	0.668	Carbohydrate sulfotransferase 15
6	9606.ENSP00000158762	0.643	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1
7	9606.ENSP00000430025	0.642	LYR motif containing 2
8	9606.ENSP00000440005	0.640	ADP-ribosylation factor 1
9	9606.ENSP00000430548	0.618	Phosphatidylserine synthase 1
10	9606.ENSP00000368140	0.614	Cardiolipin synthase (CMP-forming)
11	9606.ENSP00000442050	0.590	Ethanolamine-phosphate cytidylyltransferase
12	9606.ENSP00000255389	0.571	Phosphatidylethanolamine N-methyltransferase
13	9606.ENSP00000000233	0.550	ADP-ribosylation factor 5
14	9606.ENSP00000470383	0.547	Cytohesin-2
15	9606.ENSP00000382428	0.541	Disks large homolog 4
16	9606.ENSP00000456226	0.541	Interferon induced transmembrane protein domain containing
17	9606.ENSP00000381140	0.538	1-acyl-sn-glycerol-3-phosphate acyltransferase gamma
18	9606.ENSP00000275364	0.535	Guanine nucleotide-binding protein subunit alpha-12
19	9606.ENSP00000438085	0.524	ADP-ribosylation factor-binding protein GGA3
20	9606.ENSP00000352069	0.513	NEDD4-like E3 ubiquitin-protein ligase WWP2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	0.996	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0071840	0.961	cellular component organization or biogenesis
GO:0016043	0.799	cellular component organization
GO:0065007	0.722	biological regulation
GO:0032502	0.700	developmental process
GO:0048856	0.693	anatomical structure development
GO:0032501	0.691	multicellular organismal process
GO:0050789	0.678	regulation of biological process
GO:0007275	0.648	multicellular organism development
GO:0050794	0.627	regulation of cellular process
GO:0048731	0.561	system development
GO:0007399	0.442	nervous system development
GO:0048869	0.367	cellular developmental process
GO:0030154	0.359	cell differentiation
GO:0030030	0.314	cell projection organization
GO:0120036	0.303	plasma membrane bounded cell projection organization
GO:0030182	0.302	neuron differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005622	0.997	intracellular anatomical structure
GO:0043227	0.997	membrane-bounded organelle
GO:0071944	0.995	cell periphery
GO:0005886	0.991	plasma membrane
GO:0005737	0.990	cytoplasm
GO:0120025	0.985	plasma membrane bounded cell projection
GO:0043231	0.976	intracellular membrane-bounded organelle
GO:0012505	0.973	endomembrane system
GO:0031982	0.948	vesicle
GO:0005829	0.929	cytosol
GO:0031090	0.926	organelle membrane
GO:0030054	0.891	cell junction
GO:0031252	0.786	cell leading edge
GO:0098590	0.738	plasma membrane region
GO:0043232	0.737	intracellular non-membrane-bounded organelle
GO:0001726	0.729	ruffle
GO:0097708	0.647	intracellular vesicle
GO:0031410	0.564	cytoplasmic vesicle
GO:0031256	0.554	leading edge membrane
GO:0031253	0.534	cell projection membrane
GO:0032153	0.496	cell division site
GO:0032154	0.437	cleavage furrow
GO:0032587	0.379	ruffle membrane
GO:0098588	0.372	bounding membrane of organelle
GO:0045202	0.352	synapse
GO:0032991	0.321	protein-containing complex
GO:0005576	0.305	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]