StarFunc result for job id A5PL33

User Input

>input (1030 residues)
MRENYETLVSVGTAELLPLSAFLSPSEPGRAVGGGSHADEGQEPAGCGDPQGGQPRHSLH
LTALVQLVKEIPEFLFGEVKGAMDSPESESRGASLDGERASPEAAAAREPCPLRGLLSCL
PDGPTSQPHLATTPTDSSCSSGPTGDGVQGSPLPIKTADKPWPTRKEGPGALGGEPSPPT
HSPSRRKSHRGQERGTSEAGISPGNSPLQGLINCLKEILVPGPRHPETSPSFLPPLPSLG
TSRLTRADLGPGSPPWAVKTEAVSGDCPLQGLLHCLKELPEAQDRHPSPSGVGNRRLQEN
PGAWKRGSGGPGYLLTPPPHPDLGAGGLLSVKMENSWVQSPPGPASCQPGRQPLSPSATG
DTRGVPQPSWGPEAQAASASSSPLEALEACLKGIPPNGSSPSQLPPTSCSQNPQPGDSRS
QKPELQPHRSHSEEATREPVLPLGLQSCVRDGPSRPLAPRGTPTSFSSSSSTDWDLDFGS
PVGNQGQHPGKGSPPGSSPLQGLENCLKEIPVPVLRPAWPCSSAADRGPRRAEPRNWTAD
KEGLRAEACESARLGQGRGEAPTRSLHLVSPQVFTSSCVPACHQRGFKDPGATRPGVWRW
LPEGSAPKPSPLHCLESALRGILPVRPLRFACVGGPSPSPSPGSSSSFSGSEGEDPRPEP
DLWKPLPQERDRLPSCKPPVPLSPCPGGTPAGSSGGSPGEDPRRTEPRYCSGLGAGTAQD
PCPVSQLEKRPRVSEASRGLELGHGRPRVAAKTHERLLPQGPPELPSESPPPELPPPEAA
PPVLPASSLQPPCHCGKPLQQELHSLGAALAEKLDRLATALAGLAQEVATMRTQVNRLGR
RPQGPGPMGQASWMWTLPRGPRWAHGPGHRHLPYWRQKGPTRPKPKILRGQGESCRAGDL
QGLSRGTARRARPLPPDAPPAEPPGLHCSSSQQLLSSTPSCHAAPPAHPLLAHTGGHQSP
LPPLVPAALPLQGASPPAASADADVPTSGVAPDGIPERPKEPSSLLGGVQRALQEELWGG
EHRDPRWGAH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A5PL33	1.000	1.000	0.000	1030	1.000	1.000	A5PL33.pdb.gz	KRBA1_HUMAN Protein KRBA1 OS=Homo sapiens OX=9606 GN=KRBA1 PE=1 SV=3
2	AFDB:Q05860	0.049	0.039	9.700E-3	1466	0.166	0.117	Q05860.pdb.gz	FMN1_MOUSE Formin-1 OS=Mus musculus OX=10090 GN=Fmn1 PE=1 SV=2
3	AFDB:Q8CHP0	0.043	0.046	4.671E-2	950	0.168	0.182	Q8CHP0.pdb.gz	ZC3H3_MOUSE Zinc finger CCCH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Zc3h3 PE=1 SV=1
4	AFDB:J3KRL7	0.040	0.035	8.991E-2	1267	0.153	0.125	J3KRL7.pdb.gz	J3KRL7_HUMAN Period circadian regulator 1 OS=Homo sapiens OX=9606 GN=PER1 PE=1 SV=1
5	AFDB:B1AR10	0.045	0.044	9.600E-2	1109	0.178	0.165	B1AR10.pdb.gz	B1AR10_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
6	AFDB:F1QAC4	0.045	0.037	1.094E-1	1404	0.154	0.113	F1QAC4.pdb.gz	F1QAC4_DANRE GLI family zinc finger 1 OS=Danio rerio OX=7955 GN=gli1 PE=3 SV=1
7	AFDB:Q63560	0.053	0.056	1.248E-1	952	0.162	0.175	Q63560.pdb.gz	MAP6_RAT Microtubule-associated protein 6 OS=Rattus norvegicus OX=10116 GN=Map6 PE=1 SV=1
8	AFDB:Q9VWC6	0.060	0.042	1.332E-1	1596	0.169	0.109	Q9VWC6.pdb.gz	Q9VWC6_DROME FI17950p1 OS=Drosophila melanogaster OX=7227 GN=zld PE=2 SV=1
9	AFDB:Q924C5	0.045	0.031	1.518E-1	1678	0.171	0.105	Q924C5.pdb.gz	ALPK3_MOUSE Alpha-protein kinase 3 OS=Mus musculus OX=10090 GN=Alpk3 PE=1 SV=2
10	AFDB:Q7TSJ2	0.045	0.049	1.621E-1	906	0.161	0.183	Q7TSJ2.pdb.gz	MAP6_MOUSE Microtubule-associated protein 6 OS=Mus musculus OX=10090 GN=Map6 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A5PL33	0.0	1981	1030	1.000	1.000	KRBA1_HUMAN Protein KRBA1 OS=Homo sapiens OX=9606 GN=KRBA1 PE=1 SV=3
2	Q8IEU9	4.4	33.9	3346	0.017	0.005	Q8IEU9_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1300300 PE=4 SV=1
3	Q9VP05	7.3	33.1	1475	0.016	0.011	MED1_DROME Mediator of RNA polymerase II transcription subunit 1 OS=Drosophila melanogaster OX=7227 GN=MED1 PE=1 SV=2
4	Q9JL04	8.5	32.7	1578	0.030	0.020	FMN2_MOUSE Formin-2 OS=Mus musculus OX=10090 GN=Fmn2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15287 KRBA1	9.7e-43	154.9	KRBA1 family repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317165

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352642	0.819	Leucine-rich repeat-containing protein 61
2	9606.ENSP00000327533	0.694	Lysozyme g-like protein 2
3	9606.ENSP00000444052	0.689	Carboxylesterase 4A
4	9606.ENSP00000396163	0.680	C-type lectin domain family 2 member A
5	9606.ENSP00000309836	0.647	Coiled-coil domain-containing protein 13
6	9606.ENSP00000346478	0.625	ADAMTS-like protein 2
7	9606.ENSP00000368362	0.616	Fatty acid binding protein family
8	9606.ENSP00000343242	0.602	ZBED6 C-terminal-like protein
9	9606.ENSP00000382767	0.594	Protein sel-1 homolog 3
10	9606.ENSP00000463778	0.593	ATP-sensitive inward rectifier potassium channel 12
11	9606.ENSP00000328515	0.561	Zinc finger protein 696
12	9606.ENSP00000293443	0.543	Protein FAM171A2
13	9606.ENSP00000299882	0.532	Transmembrane protease serine 5
14	9606.ENSP00000354733	0.525	Protein strawberry notch homolog 2
15	9606.ENSP00000297071	0.522	Transformer-2 protein homolog alpha
16	9606.ENSP00000313377	0.516	Pantothenate kinase 2, mitochondrial
17	9606.ENSP00000229583	0.505	Androgen-dependent TFPI-regulating protein
18	9606.ENSP00000295728	0.504	Beta-crystallin A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0050789	0.954	regulation of biological process
GO:0050794	0.909	regulation of cellular process
GO:0019222	0.746	regulation of metabolic process
GO:0031323	0.706	regulation of cellular metabolic process
GO:0080090	0.701	regulation of primary metabolic process
GO:0051171	0.684	regulation of nitrogen compound metabolic process
GO:0010468	0.637	regulation of gene expression
GO:0019219	0.605	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.580	regulation of RNA metabolic process
GO:0008152	0.485	metabolic process
GO:0010556	0.437	regulation of macromolecule biosynthetic process
GO:0031326	0.434	regulation of cellular biosynthetic process
GO:0071704	0.431	organic substance metabolic process
GO:0044238	0.424	primary metabolic process
GO:0050896	0.410	response to stimulus
GO:0048519	0.401	negative regulation of biological process
GO:2001141	0.361	regulation of RNA biosynthetic process
GO:0044237	0.328	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0031974	0.994	membrane-enclosed lumen
GO:0005654	0.981	nucleoplasm
GO:0016020	0.345	membrane
GO:0005737	0.302	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]