StarFunc result for job id A5PLK6

User Input

>input (1076 residues)
MSSAEIIGSTNLIILLEDEVFADFFNTFLSLPVFGQTPFYTVENSQWSLWPEIPCNLIAK
YKGLLTWLEKCRLPFFCKTNLCFHYILCQEFISFIKSPEGGEELVDFWILAENILSIDEM
DLEVRDYYLSLLLMLRATHLQEGSRVVTLCNMNIKSLLNLSIWHPNQSTTRREILSHMQK
VALFKLQSYWLPNFYTHTKMTMAKEEACHGLMQEYETRLYSVCYTHIGGLPLNMSIKKCH
HFQKRYSSRKAKRKMWQLVDPDSWSLEMDLKPDAIGMPLQETCPQEKVVIQMPSLKMASS
KETRISSLEKDMHYAKISSMENKAKSHLHMEAPFETKVSTHLRTVIPIVNHSSKMTIQKA
IKQSFSLGYIHLALCADACAGNPFRDHLKKLNLKVEIQLLDLWQDLQHFLSVLLNNKKNG
NAIFRHLLGDRICELYLNEQIGPCLPLKSQTIQGLKELLPSGDVIPWIPKAQKEICKMLS
PWYDEFLDEEDYWFLLFTTQNRFISSRQHKREFIGKEENILLYKRIQQSLELSQALADMK
EMDYRQWRKIATEDLKQGGSLQVELTSPVFLTDITKMSFEELCYKNPKMAIQKISDDYKI
YCEKAPKIDFKMEIIKETKTVSRSNRKMSLLKRTLVRKPSMRPRNLTEVLLNTQHLEFFR
EFLKERKAKIPLQFLTAVQKISIETNEKICKSLIENVIKTFFQGQLSPEEMLQCDAPIIK
EIASMRHVTTSTLLTLQGHVMKSIEEKWFKDYQDLFPPHHQEVEVQSEVQISSRKPSKIV
STYLQESQKKGWMRMISFIRSFCKYRRFMLNPSKRQEFEDYLHQEMQNSKENFTTAHNTS
GRSAPPSTNVRSADQENGEITLVKRRIFGHRIITVNFAINDLYFFSEMEKFNDLVSSAHM
LQVNRAYNENDVILMRSKMNIIQKLFLNSDIPPKLRVNVPEFQKDAILAAITEGYLDRSV
FHGAIMSVFPVVMYFWKRFCFWKATRSYLQYRGKKFKDRKSPPKSTDKYPFSSGGDNAIL
RFTLLRGIEWLQPQREAISSVQNSSSSKLTQPRLVVSAMQLHPVQGQKLSYIKKEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3UYX5	0.135	0.117	7.086E-14	1258	0.142	0.122	G3UYX5.pdb.gz	RGS22_MOUSE Regulator of G-protein signaling 22 OS=Mus musculus OX=10090 GN=Rgs22 PE=1 SV=1
2	AFDB:Q8NE09	0.114	0.103	2.112E-13	1264	0.136	0.116	Q8NE09.pdb.gz	RGS22_HUMAN Regulator of G-protein signaling 22 OS=Homo sapiens OX=9606 GN=RGS22 PE=1 SV=3
3	AFDB:Q18312	0.097	0.274	1.683E-3	363	0.055	0.163	Q18312.pdb.gz	RGS3_CAEEL Regulator of G-protein signaling rgs-3 OS=Caenorhabditis elegans OX=6239 GN=rgs-3 PE=1 SV=2
4	AFDB:A0A0S2Z4M1	0.100	0.135	1.150E-2	779	0.088	0.122	A0A0S2Z4M1.pdb.gz	A0A0S2Z4M1_HUMAN Axin 1 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=AXIN1 PE=1 SV=1
5	AFDB:O35625	0.103	0.126	1.703E-2	863	0.089	0.111	O35625.pdb.gz	AXIN1_MOUSE Axin-1 OS=Mus musculus OX=10090 GN=Axin1 PE=1 SV=3
6	AFDB:B1H233	0.104	0.396	1.859E-2	242	0.035	0.157	B1H233.pdb.gz	B1H233_RAT Rgs20 protein OS=Rattus norvegicus OX=10116 GN=Rgs20 PE=2 SV=1
7	AFDB:P57094	0.103	0.131	2.028E-2	835	0.088	0.114	P57094.pdb.gz	AXIN1_DANRE Axin-1 OS=Danio rerio OX=7955 GN=axin1 PE=1 SV=2
8	PDB:7shfC	0.091	0.233	2.069E-2	400	0.043	0.115	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.
9	AFDB:O15169	0.102	0.125	2.524E-2	862	0.094	0.117	O15169.pdb.gz	AXIN1_HUMAN Axin-1 OS=Homo sapiens OX=9606 GN=AXIN1 PE=1 SV=2
10	AFDB:Q9YGY0	0.104	0.131	6.891E-2	842	0.095	0.121	Q9YGY0.pdb.gz	AXIN1_XENLA Axin-1 OS=Xenopus laevis OX=8355 GN=axin1 PE=1 SV=1
11	AFDB:Q14DJ8	0.100	0.127	7.856E-2	832	0.074	0.096	Q14DJ8.pdb.gz	Q14DJ8_MOUSE Axin 1 OS=Mus musculus OX=10090 GN=Axin1 PE=1 SV=1
12	PDB:1agrE	0.098	0.666	2.843E-1	128	0.024	0.203	1agrE.pdb.gz	Structure of RGS4 bound to AlF4--activated G(i alpha1): stabilization of the transition state for GTP hydrolysis.
13	PDB:4yhjA	0.084	0.175	5.474E-1	501	0.016	0.034	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
14	PDB:3pvuA	0.095	0.159	6.518E-1	609	0.023	0.041	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
15	PDB:4mk0A	0.087	0.142	8.471E-1	631	0.012	0.021	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
16	PDB:7et31	0.047	0.116	1.201	285	0.029	0.109	7et31.pdb.gz	Structural basis for genome packaging, retention, and ejection in human cytomegalovirus.
17	PDB:4gouA	0.105	0.182	1.370	507	0.050	0.107	4gouA.pdb.gz
18	PDB:7p5jA	0.039	0.089	1.780	399	0.049	0.133	7p5jA.pdb.gz
19	PDB:6pjxA	0.079	0.144	1.942	543	0.016	0.031	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
20	PDB:6xz4A	0.047	0.108	2.120	304	0.029	0.102	6xz4A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V112	5.23e-07	56.6	1083	0.074	0.074	G3V112_HUMAN Regulator of G protein signaling 22 OS=Homo sapiens OX=9606 GN=RGS22 PE=1 SV=1
2	Q8NE09	7.74e-07	55.8	1264	0.076	0.065	RGS22_HUMAN Regulator of G-protein signaling 22 OS=Homo sapiens OX=9606 GN=RGS22 PE=1 SV=3
3	G3UYX5	1.09e-04	48.9	1258	0.081	0.069	RGS22_MOUSE Regulator of G-protein signaling 22 OS=Mus musculus OX=10090 GN=Rgs22 PE=1 SV=1
4	A0A0S0WN65	0.029	41.2	1755	0.049	0.030	A0A0S0WN65_DROME No mechanoreceptor potential C, isoform G OS=Drosophila melanogaster OX=7227 GN=nompC PE=4 SV=1
5	A8DYV6	0.030	40.8	1726	0.049	0.031	A8DYV6_DROME No mechanoreceptor potential C, isoform D OS=Drosophila melanogaster OX=7227 GN=nompC PE=4 SV=2
6	Q9VMR4	0.031	40.8	1761	0.049	0.030	Q9VMR4_DROME No mechanoreceptor potential C, isoform H OS=Drosophila melanogaster OX=7227 GN=nompC PE=4 SV=4
7	E0A9E1	0.035	40.8	1732	0.049	0.031	E0A9E1_DROME No mechanoreceptor potential C isoform L OS=Drosophila melanogaster OX=7227 GN=nompC PE=1 SV=1
8	Q7KTN8	0.035	40.8	1735	0.049	0.031	Q7KTN8_DROME No mechanoreceptor potential C, isoform F OS=Drosophila melanogaster OX=7227 GN=nompC PE=4 SV=2
9	Q7KIQ2	0.039	40.8	1619	0.049	0.033	Q7KIQ2_DROME Mechanosensory transduction channel NOMPC OS=Drosophila melanogaster OX=7227 GN=nompC PE=2 SV=1
10	Q9H9Y4	2.4	34.3	310	0.025	0.087	GPN2_HUMAN GPN-loop GTPase 2 OS=Homo sapiens OX=9606 GN=GPN2 PE=1 SV=2
11	Q96HE9	2.8	34.3	360	0.018	0.053	PRR11_HUMAN Proline-rich protein 11 OS=Homo sapiens OX=9606 GN=PRR11 PE=1 SV=1
12	P05121	5.8	33.1	402	0.026	0.070	PAI1_HUMAN Plasminogen activator inhibitor 1 OS=Homo sapiens OX=9606 GN=SERPINE1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18253 HipN	1.1e+02	14.0	Hsp70-interacting protein N N-terminal domain
2	PF00615 RGS	3.7e-08	45.1	Regulator of G protein signaling domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000457748

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323795	0.912	Testis-expressed protein 35
2	9606.ENSP00000356607	0.910	Ras-specific guanine nucleotide-releasing factor RalGPS2
3	9606.ENSP00000286548	0.906	Guanine nucleotide-binding protein G(q) subunit alpha
4	9606.ENSP00000078429	0.900	Guanine nucleotide-binding protein subunit alpha-11
5	9606.ENSP00000262958	0.900	Guanine nucleotide-binding protein subunit alpha-15
6	9606.ENSP00000312999	0.900	Guanine nucleotide-binding protein G(i) subunit alpha-2
7	9606.ENSP00000343027	0.900	Guanine nucleotide-binding protein G(i) subunit alpha-1
8	9606.ENSP00000358867	0.900	Guanine nucleotide-binding protein G(k) subunit alpha
9	9606.ENSP00000365807	0.900	Guanine nucleotide-binding protein subunit alpha-14
10	9606.ENSP00000381339	0.900	Guanine nucleotide-binding protein G(t) subunit alpha-3
11	9606.ENSP00000478892	0.900	Guanine nucleotide-binding protein G(z) subunit alpha
12	9606.ENSP00000381098	0.649	Glutamate receptor-interacting protein 1
13	9606.ENSP00000455099	0.541	Transmembrane protein 88B
14	9606.ENSP00000368007	0.524	Transmembrane protein 240
15	9606.ENSP00000357177	0.519	Rho guanine nucleotide exchange factor 11
16	9606.ENSP00000410818	0.508	MAD2L1-binding protein
17	9606.ENSP00000383168	0.505	Poly(rC)-binding protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.856	molecular function regulator activity
GO:0030234	0.848	enzyme regulator activity
GO:0140677	0.728	molecular function activator activity
GO:0030695	0.685	GTPase regulator activity
GO:0008047	0.498	enzyme activator activity
GO:0003824	0.424	catalytic activity
GO:0017111	0.344	ribonucleoside triphosphate phosphatase activity
GO:0003924	0.328	GTPase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050896	0.992	response to stimulus
GO:0051716	0.969	cellular response to stimulus
GO:0065007	0.912	biological regulation
GO:0050794	0.898	regulation of cellular process
GO:0007154	0.749	cell communication
GO:0023052	0.739	signaling
GO:0007165	0.609	signal transduction
GO:0032501	0.454	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005634	0.982	nucleus
GO:0005886	0.969	plasma membrane
GO:0005829	0.969	cytosol
GO:0043232	0.941	intracellular non-membrane-bounded organelle
GO:0070013	0.940	intracellular organelle lumen
GO:0031981	0.919	nuclear lumen
GO:0005654	0.459	nucleoplasm
GO:0005856	0.423	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23680	0.344	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.344	nucleoside-triphosphate phosphatase.
RHEA:19669	0.328	GTP + H2O = GDP + H(+) + phosphate

[back to server]