StarFunc result for job id A5YKK6

User Input

>input (2376 residues)
MNLDSLSLALSQISYLVDNLTKKNYRASQQEIQHIVNRHGPEADRHLLRCLFSHVDFSGD
GKSSGKDFHQTQFLIQECALLITKPNFISTLSYAIDNPLHYQKSLKPAPHLFAQLSKVLK
LSKVQEVIFGLALLNSSSSDLRGFAAQFIKQKLPDLLRSYIDADVSGNQEGGFQDIAIEV
LHLLLSHLLFGQKGAFGVGQEQIDAFLKTLRRDFPQERCPVVLAPLLYPEKRDILMDRIL
PDSGGVAKTMMESSLADFMQEVGYGFCASIEECRNIIVQFGVREVTAAQVARVLGMMART
HSGLTDGIPLQSISAPGSGIWSDGKDKSDGAQAHTWNVEVLIDVLKELNPSLNFKEVTYE
LDHPGFQIRDSKGLHNVVYGIQRGLGMEVFPVDLIYRPWKHAEGQLSFIQHSLINPEIFC
FADYPCHTVATDILKAPPEDDNREIATWKSLDLIESLLRLAEVGQYEQVKQLFSFPIKHC
PDMLVLALLQINTSWHTLRHELISTLMPIFLGNHPNSAIILHYAWHGQGQSPSIRQLIMH
AMAEWYMRGEQYDQAKLSRILDVAQDLKALSMLLNGTPFAFVIDLAALASRREYLKLDKW
LTDKIREHGEPFIQACMTFLKRRCPSILGGLAPEKDQPKSAQLPPETLATMLACLQACAG
SVSQELSETILTMVANCSNVMNKARQPPPGVMPKGRPPSASSLDAISPVQIDPLAGMTSL
SIGGSAAPHTQSMQGFPPNLGSAFSTPQSPAKAFPPLSTPNQTTAFSGIGGLSSQLPVGG
LGTGSLTGIGTGALGLPAVNNDPFVQRKLGTSGLNQPTFQQSKMKPSDLSQVWPEANQHF
SKEIDDEANSYFQRIYNHPPHPTMSVDEVLEMLQRFKDSTIKREREVFNCMLRNLFEEYR
FFPQYPDKELHITACLFGGIIEKGLVTYMALGLALRYVLEALRKPFGSKMYYFGIAALDR
FKNRLKDYPQYCQHLASISHFMQFPHHLQEYIEYGQQSRDPPVKMQGSITTPGSIALAQA
QAQAQVPAKAPLAGQVSTMVTTSTTTTVAKTVTVTRPTGVSFKKDVPPSINTTNIDTLLV
ATDQTERIVEPPENIQEKIAFIFNNLSQSNMTQKVEELKETVKEEFMPWVSQYLVMKRVS
IEPNFHSLYSNFLDTLKNPEFNKMVLNETYRNIKVLLTSDKAAANFSDRSLLKNLGHWLG
MITLAKNKPILHTDLDVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTM
AIMNVLAELHQEHDLKLNLKFEIEVLCKNLALDINELKPGNLLKDKDRLKNLDEQLSAPK
KDVKQPEELPPITTTTTSTTPATNTTCTATVPPQPQYSYHDINVYSLAGLAPHITLNPTI
PLFQAHPQLKQCVRQAIERAVQELVHPVVDRSIKIAMTTCEQIVRKDFALDSEESRMRIA
AHHMMRNLTAGMAMITCREPLLMSISTNLKNSFASALRTASPQQREMMDQAAAQLAQDNC
ELACCFIQKTAVEKAGPEMDKRLATEFELRKHARQEGRRYCDPVVLTYQAERMPEQIRLK
VGGVDPKQLAVYEEFARNVPGFLPTNDLSQPTGFLAQPMKQAWATDDVAQIYDKCITELE
QHLHAIPPTLAMNPQAQALRSLLEVVVLSRNSRDAIAALGLLQKAVEGLLDATSGADADL
LLRYRECHLLVLKALQDGRAYGSPWCNKQITRCLIECRDEYKYNVEAVELLIRNHLVNMQ
QYDLHLAQSMENGLNYMAVAFAMQLVKILLVDERSVAHVTEADLFHTIETLMRINAHSRG
NAPEGLPQLMEVVRSNYEAMIDRAHGGPNFMMHSGISQASEYDDPPGLREKAEYLLREWV
NLYHSAAAGRDSTKAFSAFVGQMHQQGILKTDDLITRFFRLCTEMCVEISYRAQAEQQHN
PAANPTMIRAKCYHNLDAFVRLIALLVKHSGEATNTVTKINLLNKVLGIVVGVLLQDHDV
RQSEFQQLPYHRIFIMLLLELNAPEHVLETINFQTLTAFCNTFHILRPTKAPGFVYAWLE
LISHRIFIARMLAHTPQQKGWPMYAQLLIDLFKYLAPFLRNVELTKPMQILYKGTLRVLL
VLLHDFPEFLCDYHYGFCDVIPPNCIQLRNLILSAFPRNMRLPDPFTPNLKVDMLSEINI
APRILTNFTGVMPPQFKKDLDSYLKTRSPVTFLSDLRSNLQVSNEPGNRYNLQLINALVL
YVGTQAIAHIHNKGSTPSMSTITHSAHMDIFQNLAVDLDTEGRYLFLNAIANQLRYPNSH
THYFSCTMLYLFAEANTEAIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPAFKFWNH
EFVHCAPEIEKLFQSVAQCCMGQKQAQQVMEGTGAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A5YKK6	1.000	1.000	0.000	2376	1.000	1.000	A5YKK6.pdb.gz	CNOT1_HUMAN CCR4-NOT transcription complex subunit 1 OS=Homo sapiens OX=9606 GN=CNOT1 PE=1 SV=2
2	AFDB:Q20937	0.232	0.212	0.000	2641	0.355	0.319	Q20937.pdb.gz	CNOT1_CAEEL CCR4-NOT transcription complex subunit let-711 OS=Caenorhabditis elegans OX=6239 GN=let-711 PE=1 SV=3
3	AFDB:P87112	0.200	0.226	1.255E-79	2100	0.236	0.267	P87112.pdb.gz	NOT1_SCHPO General negative regulator of transcription subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=not1 PE=1 SV=1
4	AFDB:Q38C90	0.201	0.205	4.297E-64	2326	0.215	0.220	Q38C90.pdb.gz	Q38C90_TRYB2 NOT1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6450 PE=4 SV=1
5	AFDB:P25655	0.206	0.231	2.044E-61	2108	0.204	0.230	P25655.pdb.gz	NOT1_YEAST General negative regulator of transcription subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC39 PE=1 SV=3
6	PDB:7sukSP	0.079	0.082	2.617E-9	2234	0.112	0.119	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
7	PDB:6x9oA	0.106	0.105	3.288E-9	2425	0.120	0.118	6x9oA.pdb.gz
8	PDB:7ni5A	0.078	0.070	4.631E-9	2791	0.108	0.092	7ni5A.pdb.gz	Molecular basis of human ATM kinase inhibition.
9	PDB:7su3A	0.123	0.087	7.890E-9	3802	0.114	0.071	7su3A.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
10	PDB:7sicA	0.088	0.080	8.514E-9	2773	0.113	0.097	7sicA.pdb.gz	Structure of the human ATM kinase and mechanism of Nbs1 binding.
11	PDB:7mq8LM	0.072	0.080	1.070E-8	2005	0.112	0.133	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7mqaSP	0.087	0.084	1.294E-8	2485	0.119	0.113	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7tyrA	0.084	0.061	1.822E-8	3905	0.121	0.074	7tyrA.pdb.gz
14	PDB:7otmA	0.088	0.073	3.225E-8	3656	0.122	0.079	7otmA.pdb.gz	Structural insights into inhibitor regulation of the DNA repair protein DNA-PKcs.
15	PDB:7r04B	0.097	0.102	3.350E-8	2229	0.122	0.130	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
16	AFDB:D4A0Y2	0.093	0.092	2.615E-7	2452	0.115	0.111	D4A0Y2.pdb.gz	D4A0Y2_RAT DOP1 leucine zipper like protein A OS=Rattus norvegicus OX=10116 GN=Dop1a PE=1 SV=3
17	AFDB:Q2QCI8	0.078	0.083	8.183E-5	2173	0.093	0.102	Q2QCI8.pdb.gz	MED12_DANRE Mediator of RNA polymerase II transcription subunit 12 OS=Danio rerio OX=7955 GN=med12 PE=2 SV=1
18	AFDB:E9PKF6	0.054	0.096	2.286E-4	838	0.045	0.128	E9PKF6.pdb.gz	E9PKF6_HUMAN Protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=1
19	AFDB:A2A690	0.075	0.084	4.122E-3	1994	0.053	0.064	A2A690.pdb.gz	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1
20	AFDB:Q38CA8	0.072	0.161	6.031E-3	715	0.030	0.099	Q38CA8.pdb.gz	Q38CA8_TRYB2 Protein kinase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6740 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4LEZ3	0.0	2097	2511	0.492	0.465	A0A0B4LEZ3_DROME Not1, isoform H OS=Drosophila melanogaster OX=7227 GN=Not1 PE=1 SV=1
2	A1A5H6	0.0	4388	2374	0.902	0.903	CNOT1_DANRE CCR4-NOT transcription complex subunit 1 OS=Danio rerio OX=7955 GN=cnot1 PE=2 SV=1
3	A5YKK6	0.0	4953	2376	1.000	1.000	CNOT1_HUMAN CCR4-NOT transcription complex subunit 1 OS=Homo sapiens OX=9606 GN=CNOT1 PE=1 SV=2
4	A8DY80	0.0	2123	2503	0.497	0.471	A8DY80_DROME Not1, isoform D OS=Drosophila melanogaster OX=7227 GN=Not1 PE=1 SV=1
5	A8DY81	0.0	2118	2505	0.497	0.471	A8DY81_DROME Not1, isoform C OS=Drosophila melanogaster OX=7227 GN=Not1 PE=1 SV=1
6	A8DY82	0.0	2026	2220	0.461	0.493	A8DY82_DROME Not1, isoform E OS=Drosophila melanogaster OX=7227 GN=Not1 PE=1 SV=1
7	E2QCN4	0.0	2101	2492	0.493	0.470	E2QCN4_DROME Not1, isoform F OS=Drosophila melanogaster OX=7227 GN=Not1 PE=1 SV=1
8	Q20937	0.0	1219	2641	0.294	0.264	CNOT1_CAEEL CCR4-NOT transcription complex subunit let-711 OS=Caenorhabditis elegans OX=6239 GN=let-711 PE=1 SV=3
9	Q6ZQ08	0.0	4921	2375	0.994	0.994	CNOT1_MOUSE CCR4-NOT transcription complex subunit 1 OS=Mus musculus OX=10090 GN=Cnot1 PE=1 SV=2
10	Q8IH39	0.0	825	669	0.169	0.599	Q8IH39_DROME GH26494p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Not1 PE=2 SV=1
11	Q95TG6	0.0	607	581	0.127	0.520	Q95TG6_DROME SD07194p OS=Drosophila melanogaster OX=7227 GN=Not1 PE=2 SV=1
12	P87112	7.79e-177	600	2100	0.199	0.225	NOT1_SCHPO General negative regulator of transcription subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=not1 PE=1 SV=1
13	F4HVV6	4.32e-160	554	2431	0.136	0.132	F4HVV6_ARATH Transcription regulator OS=Arabidopsis thaliana OX=3702 GN=NOT1 PE=1 SV=1
14	A0A1D8PQD2	3.94e-70	265	2016	0.086	0.102	A0A1D8PQD2_CANAL CCR4-NOT core subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC39 PE=4 SV=1
15	P25655	8.40e-61	234	2108	0.079	0.089	NOT1_YEAST General negative regulator of transcription subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC39 PE=1 SV=3
16	Q38C90	3.51e-59	229	2326	0.059	0.061	Q38C90_TRYB2 NOT1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.6450 PE=4 SV=1
17	Q5WA50	3.0	35.4	426	0.015	0.082	CTR2_OCTVU Cephalotocin receptor 2 OS=Octopus vulgaris OX=6645 GN=CTR2 PE=2 SV=1
18	Q9BYE2	7.7	34.3	586	0.011	0.043	TMPSD_HUMAN Transmembrane protease serine 13 OS=Homo sapiens OX=9606 GN=TMPRSS13 PE=1 SV=5
19	Q05215	8.1	33.9	589	0.013	0.054	EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens OX=9606 GN=EGR4 PE=1 SV=3
20	Q583W2	8.1	34.3	681	0.011	0.038	Q583W2_TRYB2 RRM domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.1150 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16415 CNOT1_CAF1_bind	1.9e-90	313.7	CCR4-NOT transcription complex subunit 1 CAF1-binding domain
2	PF16418 CNOT1_HEAT	1.8e-50	182.3	CCR4-NOT transcription complex subunit 1 HEAT repeat
3	PF16417 CNOT1_TTP_bind	1.4e-76	267.4	CCR4-NOT transcription complex subunit 1 TTP binding domain
4	PF12842 DUF3819	1.4e-49	179.2	CCR4-Not complex, Not1 subunit, domain of unknown function DUF3819
5	PF04054 Not1	7.7e-149	507.2	CCR4-Not complex component, Not1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320949

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229195	0.999	CCR4-NOT transcription complex subunit 2
2	9606.ENSP00000273064	0.999	CCR4-NOT transcription complex subunit 9
3	9606.ENSP00000289382	0.999	CCR4-NOT transcription complex subunit 11
4	9606.ENSP00000351159	0.999	CCR4-NOT transcription complex subunit 3
5	9606.ENSP00000355279	0.999	CCR4-NOT transcription complex subunit 7
6	9606.ENSP00000377024	0.999	CCR4-NOT transcription complex subunit 6
7	9606.ENSP00000424896	0.999	CCR4-NOT transcription complex subunit 6-like
8	9606.ENSP00000430493	0.999	CCR4-NOT transcription complex subunit 8
9	9606.ENSP00000445508	0.999	CCR4-NOT transcription complex subunit 4
10	9606.ENSP00000478754	0.999	Probable ATP-dependent RNA helicase DDX6
11	9606.ENSP00000379144	0.998	Trinucleotide repeat-containing gene 6A protein
12	9606.ENSP00000399862	0.997	CCR4-NOT transcription complex subunit 10
13	9606.ENSP00000393275	0.990	Nanos homolog 1
14	9606.ENSP00000427695	0.982	Protein Tob1
15	9606.ENSP00000326381	0.978	Eukaryotic initiation factor 4A-II
16	9606.ENSP00000313007	0.975	Polyadenylate-binding protein 1
17	9606.ENSP00000416255	0.968	Eukaryotic translation initiation factor 4 gamma 1
18	9606.ENSP00000437271	0.965	182 kDa tankyrase-1-binding protein
19	9606.ENSP00000380659	0.961	Eukaryotic translation initiation factor 4E transporter
20	9606.ENSP00000302768	0.959	Polyadenylate-binding protein-interacting protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0003723	0.987	RNA binding
GO:0003824	0.949	catalytic activity
GO:0140640	0.875	catalytic activity, acting on a nucleic acid
GO:0140098	0.849	catalytic activity, acting on RNA
GO:0016787	0.841	hydrolase activity
GO:0004540	0.832	ribonuclease activity
GO:0004527	0.831	exonuclease activity
GO:0070016	0.710	armadillo repeat domain binding
GO:0030331	0.703	nuclear estrogen receptor binding
GO:0042974	0.701	nuclear retinoic acid receptor binding
GO:0004535	0.695	poly(A)-specific ribonuclease activity
GO:0060090	0.556	molecular adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0009987	0.982	cellular process
GO:0009889	0.980	regulation of biosynthetic process
GO:0009892	0.979	negative regulation of metabolic process
GO:0050794	0.977	regulation of cellular process
GO:0010608	0.975	post-transcriptional regulation of gene expression
GO:0048523	0.971	negative regulation of cellular process
GO:0031326	0.970	regulation of cellular biosynthetic process
GO:0010605	0.965	negative regulation of macromolecule metabolic process
GO:0080090	0.959	regulation of primary metabolic process
GO:0051171	0.959	regulation of nitrogen compound metabolic process
GO:0032502	0.945	developmental process
GO:0034248	0.933	regulation of amide metabolic process
GO:2000112	0.931	regulation of cellular macromolecule biosynthetic process
GO:0051172	0.922	negative regulation of nitrogen compound metabolic process
GO:0031324	0.922	negative regulation of cellular metabolic process
GO:0048518	0.918	positive regulation of biological process
GO:0010629	0.902	negative regulation of gene expression
GO:0010558	0.899	negative regulation of macromolecule biosynthetic process
GO:0031327	0.899	negative regulation of cellular biosynthetic process
GO:0032501	0.898	multicellular organismal process
GO:0051246	0.898	regulation of protein metabolic process
GO:0048522	0.885	positive regulation of cellular process
GO:0006417	0.836	regulation of translation
GO:0048856	0.808	anatomical structure development
GO:1903311	0.756	regulation of mRNA metabolic process
GO:0051248	0.750	negative regulation of protein metabolic process
GO:0048869	0.713	cellular developmental process
GO:0008152	0.709	metabolic process
GO:0007275	0.707	multicellular organism development
GO:0009893	0.705	positive regulation of metabolic process
GO:0030154	0.702	cell differentiation
GO:0010604	0.702	positive regulation of macromolecule metabolic process
GO:0071704	0.701	organic substance metabolic process
GO:0051173	0.682	positive regulation of nitrogen compound metabolic process
GO:0031325	0.681	positive regulation of cellular metabolic process
GO:0034249	0.623	negative regulation of amide metabolic process
GO:0009894	0.621	regulation of catabolic process
GO:0031329	0.610	regulation of cellular catabolic process
GO:0001701	0.607	in utero embryonic development
GO:0051239	0.587	regulation of multicellular organismal process
GO:0044238	0.569	primary metabolic process
GO:0017148	0.549	negative regulation of translation
GO:0006807	0.545	nitrogen compound metabolic process
GO:0045935	0.518	positive regulation of nucleobase-containing compound metabolic process
GO:0065008	0.501	regulation of biological quality
GO:0051254	0.501	positive regulation of RNA metabolic process
GO:0043170	0.485	macromolecule metabolic process
GO:0001824	0.482	blastocyst development
GO:0044237	0.480	cellular metabolic process
GO:0061013	0.427	regulation of mRNA catabolic process
GO:0048583	0.413	regulation of response to stimulus
GO:0043487	0.412	regulation of RNA stability
GO:0043488	0.386	regulation of mRNA stability
GO:0050793	0.378	regulation of developmental process
GO:1903313	0.370	positive regulation of mRNA metabolic process
GO:0009896	0.339	positive regulation of catabolic process
GO:0034641	0.324	cellular nitrogen compound metabolic process
GO:0031331	0.324	positive regulation of cellular catabolic process
GO:0006139	0.310	nucleobase-containing compound metabolic process
GO:0009966	0.306	regulation of signal transduction
GO:0090304	0.303	nucleic acid metabolic process
GO:0061014	0.300	positive regulation of mRNA catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0016020	0.994	membrane
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0032991	0.992	protein-containing complex
GO:0005829	0.991	cytosol
GO:0036464	0.990	cytoplasmic ribonucleoprotein granule
GO:0000932	0.980	P-body
GO:0070013	0.890	intracellular organelle lumen
GO:0005576	0.887	extracellular region
GO:0031981	0.810	nuclear lumen
GO:0031090	0.792	organelle membrane
GO:0005654	0.776	nucleoplasm
GO:0140535	0.733	intracellular protein-containing complex
GO:0005615	0.685	extracellular space
GO:0030014	0.645	CCR4-NOT complex
GO:0098588	0.543	bounding membrane of organelle
GO:0005777	0.311	peroxisome
GO:0005778	0.300	peroxisomal membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.841	Hydrolases.
EC:3.1.-.-	0.833	Acting on ester bonds.
EC:3.1.13.4	0.695	poly(A)-specific ribonuclease.

[back to server]