StarFunc result for job id A5YM69

User Input

>input (484 residues)
MEAEEAQHGASPPISAIEEFSIIPEAPMRSSQVSALGLEAQEDEDPSYKWREEHRLSATQ
QSELRDVCDYAIETMPSFPKEGSADVEPNQESLVAEACDTPEHWEAVPQSLAGRQARTLA
PPELWACPIQSEHLDMAPFSSDLGSEEEEVEFWPGLTSLTLGSGQAEEEEETSSDNSGQT
RYYSPCEEHPAETNQNEGAESGTIRQGEELPSEELQESQGLLHPQEVQVLEEQGQQEAGF
RGEGTLREDVCADGLLGEEQMIEQVNDEKGEQKQKQEQVQDVMLGRQGERMGLTGEPEGL
NDGEWEQEDMERKAQGQGGPEQGEERKRELQVPEENRADSQDEKSQTFLGKSEEVTGKQE
DHGIKEKGVPVSGQEAKEPESWDGGRLGAVGRARSREEENEHHGPSMPALIAPEDSPHCD
LFPGASYLVTQIPGTQTESRAEELSPAALSPLLEPIRCSHQPISLLGSFLTEESPDKEKL
LSVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12774	0.069	0.032	9.777E-61	1597	0.977	0.296	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
2	AFDB:Q5QJE6	0.062	0.043	7.366E-1	756	0.153	0.098	Q5QJE6.pdb.gz	TDIF2_HUMAN Deoxynucleotidyltransferase terminal-interacting protein 2 OS=Homo sapiens OX=9606 GN=DNTTIP2 PE=1 SV=2
3	AFDB:Q14679	0.058	0.028	1.227	1199	0.159	0.064	Q14679.pdb.gz	TTLL4_HUMAN Tubulin monoglutamylase TTLL4 OS=Homo sapiens OX=9606 GN=TTLL4 PE=1 SV=2
4	AFDB:Q4WPF5	0.058	0.048	1.584	618	0.169	0.133	Q4WPF5.pdb.gz	SEBA_ASPFU C2H2 finger domain transcription factor sebA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=sebA PE=4 SV=1
5	AFDB:Q9BVI0	0.065	0.036	1.584	1012	0.143	0.068	Q9BVI0.pdb.gz	PHF20_HUMAN PHD finger protein 20 OS=Homo sapiens OX=9606 GN=PHF20 PE=1 SV=2
6	AFDB:P47043	0.074	0.046	1.725	880	0.130	0.072	P47043.pdb.gz	ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZAP1 PE=1 SV=1
7	AFDB:P52890	0.065	0.058	2.045	566	0.143	0.122	P52890.pdb.gz	ATF1_SCHPO Transcription factor atf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atf1 PE=1 SV=1
8	AFDB:Q8IUG5	0.051	0.016	2.045	2567	0.165	0.031	Q8IUG5.pdb.gz	MY18B_HUMAN Unconventional myosin-XVIIIb OS=Homo sapiens OX=9606 GN=MYO18B PE=1 SV=2
9	AFDB:Q5D869	0.053	0.018	2.640	1976	0.147	0.036	Q5D869.pdb.gz	NRPE1_ARATH DNA-directed RNA polymerase V subunit 1 OS=Arabidopsis thaliana OX=3702 GN=NRPE1 PE=1 SV=1
10	AFDB:Q7KQZ4	0.063	0.043	2.640	787	0.165	0.102	Q7KQZ4.pdb.gz	LOLA3_DROME Longitudinals lacking protein, isoforms A/B/D/L OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q12774	0.0	949	1597	0.977	0.296	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
2	E9Q7D5	6.96e-80	273	1581	0.446	0.137	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
3	Q6FIU8	0.058	38.9	4880	0.091	0.009	Q6FIU8_CANGA Midasin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0M11616g PE=3 SV=1
4	Q9L7Q2	0.19	37.0	1906	0.087	0.022	ZMPB_STRPN Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=zmpB PE=3 SV=2
5	Q39659	1.8	33.5	725	0.039	0.026	MFPA_CUCSA Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Cucumis sativus OX=3659 PE=1 SV=1
6	Q8I3S3	3.9	32.7	1894	0.056	0.014	Q8I3S3_PLAF7 mRNA-binding protein PUF1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518700 PE=4 SV=1
7	A0A1B0GUD6	6.4	32.0	877	0.107	0.059	A0A1B0GUD6_HUMAN GRAM domain containing 1B OS=Homo sapiens OX=9606 GN=GRAMD1B PE=1 SV=1
8	Q3KR37	7.2	31.6	738	0.107	0.070	ASTRB_HUMAN Protein Aster-B OS=Homo sapiens OX=9606 GN=GRAMD1B PE=1 SV=1
9	Q6P9K9	7.2	32.0	1571	0.062	0.019	NRX3A_MOUSE Neurexin-3 OS=Mus musculus OX=10090 GN=Nrxn3 PE=1 SV=2
10	Q8IDX6	7.3	32.0	3130	0.050	0.008	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15441 ARHGEF5_35	9.8e-226	762.1	RhoGEF 5/35 N-terminal disordered region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367355

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328083	0.650	Rho guanine nucleotide exchange factor 37
2	9606.ENSP00000298815	0.614	Rho GTPase-activating protein 42
3	9606.ENSP00000248984	0.602	Uncharacterized protein C22orf24
4	9606.ENSP00000386702	0.601	Myeloid-associated differentiation marker-like protein 2
5	9606.ENSP00000250617	0.597	Rho guanine nucleotide exchange factor 6
6	9606.ENSP00000364277	0.574	FYVE, RhoGEF and PH domain-containing protein 1
7	9606.ENSP00000471635	0.547	Uncharacterized protein
8	9606.ENSP00000298694	0.539	Rho guanine nucleotide exchange factor 40
9	9606.ENSP00000355060	0.533	Rho guanine nucleotide exchange factor 10-like protein
10	9606.ENSP00000416125	0.525	Rho guanine nucleotide exchange factor 38
11	9606.ENSP00000410603	0.518	Protein FAM131B
12	9606.ENSP00000341737	0.512	Adaptin ear-binding coat-associated protein 1
13	9606.ENSP00000348828	0.506	Rho guanine nucleotide exchange factor 26
14	9606.ENSP00000392371	0.506	Zinc finger and SCAN domain-containing protein 30
15	9606.ENSP00000264051	0.503	Ephexin-1
16	9606.ENSP00000380942	0.502	Rho guanine nucleotide exchange factor 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0005525	1.000	GTP binding
GO:0019899	0.385	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.954	biological regulation
GO:0050794	0.939	regulation of cellular process
GO:0009987	0.838	cellular process
GO:0048583	0.795	regulation of response to stimulus
GO:0010646	0.593	regulation of cell communication
GO:0023051	0.592	regulation of signaling
GO:0009966	0.584	regulation of signal transduction
GO:1902531	0.546	regulation of intracellular signal transduction
GO:0051056	0.381	regulation of small GTPase mediated signal transduction
GO:0051128	0.361	regulation of cellular component organization
GO:0019222	0.308	regulation of metabolic process
GO:0048522	0.308	positive regulation of cellular process
GO:0065009	0.306	regulation of molecular function
GO:0033043	0.303	regulation of organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.999	membrane
GO:0005634	0.997	nucleus
GO:0005886	0.991	plasma membrane
GO:0005654	0.988	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]