StarFunc result for job id A6BM72

User Input

>input (1044 residues)
MVLSLTGLIAFSFLQATLALNPEDPNVCSHWESYAVTVQESYAHPFDQIYYTRCTDILNW
FKCTRHRISYKTAYRRGLRTMYRRRSQCCPGYYESGDFCIPLCTEECVHGRCVSPDTCHC
EPGWGGPDCSSGCDSDHWGPHCSNRCQCQNGALCNPITGACVCAAGFRGWRCEELCAPGT
HGKGCQLPCQCRHGASCDPRAGECLCAPGYTGVYCEELCPPGSHGAHCELRCPCQNGGTC
HHITGECACPPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVTGQCHCTAGYMGDR
CQEECPFGSFGFQCSQHCDCHNGGQCSPTTGACECEPGYKGPRCQERLCPEGLHGPGCTL
PCPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVGYYGDGCQLPCTCQNGADCHSITG
GCTCAPGFMGEVCAVSCAAGTYGPNCSSICSCNNGGTCSPVDGSCTCKEGWQGLDCTLPC
PSGTWGLNCNESCTCANGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDCSH
ADGCDPVTGHCCCLAGWTGIRCDSTCPPGRWGPNCSVSCSCENGGSCSPEDGSCECAPGF
RGPLCQRICPPGFYGHGCAQPCPLCVHSSRPCHHISGICECLPGFSGALCNQVCAGGYFG
QDCAQLCSCANNGTCSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHACSCHNGASCSA
EDGACHCTPGWTGLFCTQRCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGQHCE
QRCAPGTFGYGCQQLCECMNNSTCDHVTGTCYCSPGFKGIRCDQAALMMEELNPYTKISP
ALGAERHSVGAVTGIMLLLFLIVVLLGLFAWHRRRQKEKGRDLAPRVSYTPAMRMTSTDY
SLSGACGMDRRQNTYIMDKGFKDYMKESVCSSSTCSLNSSENPYATIKDPPILTCKLPES
SYVEMKSPVHMGSPYTDVPSLSTSNKNIYEVEPTVSVVQEGCGHNSSYIQNAYDLPRNSH
IPGHYDLLPVRQSPANGPSQDKQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6BM72	0.999	0.999	0.000	1044	1.000	1.000	A6BM72.pdb.gz	MEG11_HUMAN Multiple epidermal growth factor-like domains protein 11 OS=Homo sapiens OX=9606 GN=MEGF11 PE=1 SV=3
2	AFDB:E9QJQ6	0.363	0.341	0.000	1119	0.623	0.581	E9QJQ6.pdb.gz	MEG10_DANRE Multiple epidermal growth factor-like domains protein 10 OS=Danio rerio OX=7955 GN=megf10 PE=1 SV=1
3	AFDB:Q6DIB5	0.431	0.401	0.000	1147	0.634	0.577	Q6DIB5.pdb.gz	MEG10_MOUSE Multiple epidermal growth factor-like domains protein 10 OS=Mus musculus OX=10090 GN=Megf10 PE=1 SV=1
4	AFDB:Q80T91	0.251	0.241	0.000	1091	0.888	0.850	Q80T91.pdb.gz	MEG11_MOUSE Multiple epidermal growth factor-like domains protein 11 OS=Mus musculus OX=10090 GN=Megf11 PE=1 SV=3
5	AFDB:Q5VY43	0.184	0.185	1.521E-103	1037	0.431	0.434	Q5VY43.pdb.gz	PEAR1_HUMAN Platelet endothelial aggregation receptor 1 OS=Homo sapiens OX=9606 GN=PEAR1 PE=1 SV=1
6	AFDB:Q8VIK5	0.183	0.185	7.526E-102	1034	0.423	0.427	Q8VIK5.pdb.gz	PEAR1_MOUSE Platelet endothelial aggregation receptor 1 OS=Mus musculus OX=10090 GN=Pear1 PE=1 SV=1
7	AFDB:Q9W0A0	0.232	0.234	4.159E-96	1031	0.335	0.339	Q9W0A0.pdb.gz	DRPR_DROME Protein draper OS=Drosophila melanogaster OX=7227 GN=drpr PE=1 SV=3
8	AFDB:Q9XWD6	0.256	0.243	1.798E-93	1111	0.337	0.317	Q9XWD6.pdb.gz	CED1_CAEEL Cell death abnormality protein 1 OS=Caenorhabditis elegans OX=6239 GN=ced-1 PE=1 SV=1
9	AFDB:O75095	0.167	0.118	1.417E-82	1541	0.314	0.213	O75095.pdb.gz	MEGF6_HUMAN Multiple epidermal growth factor-like domains protein 6 OS=Homo sapiens OX=9606 GN=MEGF6 PE=1 SV=4
10	PDB:5es4B	0.060	0.083	4.901E-3	674	0.039	0.061	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
11	PDB:7nxdB	0.061	0.083	2.491E-2	690	0.038	0.058	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
12	PDB:4g1eB	0.065	0.085	2.776E-2	709	0.041	0.061	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
13	PDB:7q3nU	0.081	0.172	7.362E-2	292	0.051	0.182	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
14	AFDB:Q8K1S2	0.040	0.043	1.437E-1	956	0.034	0.037	Q8K1S2.pdb.gz	UNC5D_MOUSE Netrin receptor UNC5D OS=Mus musculus OX=10090 GN=Unc5d PE=1 SV=1
15	PDB:6uzbA	0.042	0.069	4.647E-1	562	0.002	0.004	6uzbA.pdb.gz	Atomic structures of anthrax toxin protective antigen channels bound to partially unfolded lethal and edema factors.
16	PDB:3b07B	0.039	0.114	7.169E-1	270	0.006	0.022	3b07B.pdb.gz
17	PDB:6sb3A	0.043	0.066	7.169E-1	604	0.012	0.022	6sb3A.pdb.gz
18	PDB:7bk0B	0.032	0.099	8.904E-1	250	0.007	0.028	7bk0B.pdb.gz
19	PDB:6qz90A	0.048	0.127	1.531	291	0.004	0.014	6qz90A.pdb.gz
20	PDB:6yxxED	0.032	0.052	1.706	598	0.004	0.007	6yxxED.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6BM72	0.0	2089	1044	1.000	1.000	MEG11_HUMAN Multiple epidermal growth factor-like domains protein 11 OS=Homo sapiens OX=9606 GN=MEGF11 PE=1 SV=3
2	E9QJQ6	0.0	1186	1119	0.555	0.517	MEG10_DANRE Multiple epidermal growth factor-like domains protein 10 OS=Danio rerio OX=7955 GN=megf10 PE=1 SV=1
3	Q5VY43	0.0	690	1037	0.354	0.357	PEAR1_HUMAN Platelet endothelial aggregation receptor 1 OS=Homo sapiens OX=9606 GN=PEAR1 PE=1 SV=1
4	Q6DIB5	0.0	1222	1147	0.573	0.521	MEG10_MOUSE Multiple epidermal growth factor-like domains protein 10 OS=Mus musculus OX=10090 GN=Megf10 PE=1 SV=1
5	Q80T91	0.0	1720	1091	0.858	0.821	MEG11_MOUSE Multiple epidermal growth factor-like domains protein 11 OS=Mus musculus OX=10090 GN=Megf11 PE=1 SV=3
6	Q8VIK5	0.0	733	1034	0.427	0.431	PEAR1_MOUSE Platelet endothelial aggregation receptor 1 OS=Mus musculus OX=10090 GN=Pear1 PE=1 SV=1
7	Q96KG7	0.0	1222	1140	0.581	0.532	MEG10_HUMAN Multiple epidermal growth factor-like domains protein 10 OS=Homo sapiens OX=9606 GN=MEGF10 PE=1 SV=1
8	Q9W0A0	0.0	610	1031	0.322	0.326	DRPR_DROME Protein draper OS=Drosophila melanogaster OX=7227 GN=drpr PE=1 SV=3
9	Q9XWD6	2.07e-167	523	1111	0.322	0.302	CED1_CAEEL Cell death abnormality protein 1 OS=Caenorhabditis elegans OX=6239 GN=ced-1 PE=1 SV=1
10	Q80V70	9.74e-162	519	1572	0.304	0.202	MEGF6_MOUSE Multiple epidermal growth factor-like domains protein 6 OS=Mus musculus OX=10090 GN=Megf6 PE=2 SV=3
11	O75095	1.29e-157	508	1541	0.298	0.202	MEGF6_HUMAN Multiple epidermal growth factor-like domains protein 6 OS=Homo sapiens OX=9606 GN=MEGF6 PE=1 SV=4
12	Q14162	6.80e-54	205	830	0.145	0.182	SREC_HUMAN Scavenger receptor class F member 1 OS=Homo sapiens OX=9606 GN=SCARF1 PE=1 SV=3
13	Q5ND28	4.26e-53	202	820	0.141	0.179	SREC_MOUSE Scavenger receptor class F member 1 OS=Mus musculus OX=10090 GN=Scarf1 PE=1 SV=1
14	P59222	1.40e-48	189	833	0.131	0.164	SREC2_MOUSE Scavenger receptor class F member 2 OS=Mus musculus OX=10090 GN=Scarf2 PE=1 SV=1
15	Q96GP6	2.46e-48	188	871	0.132	0.158	SREC2_HUMAN Scavenger receptor class F member 2 OS=Homo sapiens OX=9606 GN=SCARF2 PE=1 SV=5
16	F1RCH4	1.33e-36	153	2475	0.221	0.093	F1RCH4_DANRE Neurogenic locus notch homolog protein 2 precursor OS=Danio rerio OX=7955 GN=notch6 PE=3 SV=1
17	Q99466	5.21e-36	151	2003	0.261	0.136	NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens OX=9606 GN=NOTCH4 PE=1 SV=2
18	P21783	1.06e-35	150	2524	0.217	0.090	NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3
19	A2RUV0	1.14e-35	150	2522	0.215	0.089	NOTC1_XENTR Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis OX=8364 GN=notch1 PE=1 SV=2
20	P07207	1.46e-35	150	2703	0.245	0.095	NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster OX=7227 GN=N PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01414 DSL	49	15.6	Delta serrate ligand
2	PF00008 EGF	18	17.1	EGF-like domain
3	PF07974 EGF_2	0.049	25.3	EGF-like domain
4	PF12661 hEGF	5.9e-14	63.3	Human growth factor-like EGF
5	PF00053 Laminin_EGF	1.3e-46	167.8	Laminin EGF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386908

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367739	0.745	Neurensin-1
2	9606.ENSP00000298119	0.737	Leucine-rich repeat and fibronectin type-III domain-containing protein 5
3	9606.ENSP00000281703	0.683	Glycosyltransferase 1 domain-containing protein 1
4	9606.ENSP00000267273	0.681	Protein-lysine methyltransferase METTL21C
5	9606.ENSP00000386289	0.675	PTB domain-containing engulfment adapter protein 1
6	9606.ENSP00000297788	0.619	Coiled-coil domain-containing protein 136
7	9606.ENSP00000310431	0.605	Protein ERGIC-53-like
8	9606.ENSP00000468263	0.602	ELKS/Rab6-interacting/CAST family member 1
9	9606.ENSP00000265171	0.587	Pro-epidermal growth factor
10	9606.ENSP00000296266	0.536	Intraflagellar transport protein 122 homolog
11	9606.ENSP00000367715	0.526	Doublecortin domain-containing protein 2
12	9606.ENSP00000263665	0.500	Contactin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	1.000	cellular process
GO:0008150	1.000	biological_process
GO:0050789	0.965	regulation of biological process
GO:0048856	0.925	anatomical structure development
GO:0032501	0.923	multicellular organismal process
GO:0007275	0.866	multicellular organism development
GO:0048731	0.805	system development
GO:0050794	0.798	regulation of cellular process
GO:0007155	0.774	cell adhesion
GO:0034109	0.763	homotypic cell-cell adhesion
GO:0048518	0.537	positive regulation of biological process
GO:0009653	0.524	anatomical structure morphogenesis
GO:0048513	0.472	animal organ development
GO:0050896	0.450	response to stimulus
GO:0048522	0.390	positive regulation of cellular process
GO:0048646	0.375	anatomical structure formation involved in morphogenesis
GO:0007423	0.349	sensory organ development
GO:0071840	0.327	cellular component organization or biogenesis
GO:0051179	0.313	localization
GO:0016043	0.303	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0001891	0.880	phagocytic cup
GO:0005622	0.357	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]