StarFunc result for job id A6H8Y1

User Input

>input (2624 residues)
MFRRARLSVKPNVRPGVGARGSTASNPQRGRESPRPPDPATDSASKPAEPTDVPTVDFGG
AEPQEKAPRSSTEKTGGDNDVEESSRSSSTVSQRRKRISSTSSLVKSSVSVPSESHPLST
INQEAPQPTATSTKEKQPCSDRYRIYKAQKLREMLKEELRKEKKQWKNKYAINESQRPPD
RSKMTMRDFIYYLPDNNPMTSSLEQEKKTEKPSTPVQTREQEGKSTPNAEDNEMEEETDD
GPLLVPRVKVAEDGSIILDEESLTVEVLRTKGPCVVEENDPIFERGSTTTYSSFRKNYYS
KPWSNKETDMFFLAISMVGTDFSMIGQLFPHRARIEIKNKFKREEKTNGWRIDKAFQEKR
PFDFDFFAHLLQKVLAEEEKRKQKSVKNHSLKEKKSTKPRKNVKVKKVACEGVNNDPDES
MSSRISDTERSQKDAQTVEEESLTLSREDAEQVALEVDLNQKKRRRKKQDGANELGVNNL
LENATVQAGPSKGEKHKNKCQAIRPELKEGECSKEQMLSCTQNIDGIVGFASTEKVEKRT
DPILSLSNQQDATSVATESSESSTSDLPSFEVGIRALCEVNNAEGSCIEERNVDLKNNSL
EIDQTENVKPMLRGRFQRPKPNLSRAGKKSVLSQGKTESESKNSHSKTSVEKNHVEKDKM
NTLDILRMETTERENPEAETVSVLGEKNCLQEGSQLKALRPVQVRGRLQKPKPNAGKAAE
RKEILISQEEIGANVEKNENESCADRDTPQHMEDQSRKDFEEEDVILQPEKNDSFQNVQP
DEPKVLNECLSVQENNKANKLNQVPILRTRFQKPKPNIGRGTGRREISSKEEVLEKILVS
GEMAAALRETVRLDTSPKEMVPAEINTKEMQSDLKETGRRAISPREKILDVIDDTIEMET
GLKAMGREICLREKTPEVIDATEEIDKDLEEAGRREISPQKNGPEEVKPLGEVETDLKAT
GNESSPREKTPEVTDATEEIDKNLEETGRRKISPRENGPEEVKPVDEMETDLNATGRESS
PREKTPEVIDATEEIDLEETEREVSPQENGLEEVKPLGEMETDLKATGRDSFPRGKTPEV
IDAIEEIEIDLEETEREISPQENGLEEVKPLGEMQTDLKATGREISPREKTPEVIDATEE
IDKDLEETGRREISPEENGPEEVKPVDEMETDLKTTGREGSSREKTREVIDAAEVIETDL
EETEREISPQENGPEEVKPVGKMETDLKEIREEISQREKVLAEFSAIREKEIDLKETGKR
DIPIMEKVSGKMAVVEEMEADLKETGKENFRERGSEEICVTEEKVAELKQTGKTDISPRE
NELEETSTSRQTDTHLMQSGSNDFSAVPSLDIQNISSEVLSMMHTPVEEKRNSEKEVSSH
FSHFKISSQTHESDKTEVQGIQSPDVPEQFSDINLSKSLPQEQKPLEIKPAPFVRSRFKR
PKPNLARAALKRETTESEKYIYEKKSETKKMETIVMQENNEQTDTLPSQHDEASLMISRE
KDTLGHRNEEAVILPCTQTERNLSPSNSCEPKEESQSAPVQKNDSVVSVGTNNVNTFQQE
MKESVIQTARQVRGRLQRPRPNIRKTGQRQIVDKGEAKGIIKEGRTILPKDETEKKVLTV
SNSQIETEIEVPSSAVPEHRMYENQSQVVLVENLHVNKTNETIRHENKPYVPSSAQMTRR
KFQKAKPNLGRAHSKKEEPVLEKVTTDQSKEGKPEDHLLQKGASNTQLLLKEKAELLTSL
EVSARKDCVGSKESALAKIDAELEEVGPSRRVGEETVGDNSPSSVVEEQYLNKLTSCPQP
LNETSYSKIALDGKTTISSTSEYERNRGERRSHKKFKPNVTRGRGSKRVRGKTSKKEPRA
SKAMLVTLRASQEEDDDADDFESDYEEESYHLAPEEVNKAPVFVPVGLRSPEPVSAQIEE
TMEELEITVNVPDVGCIAVVEHELPNTDVTTEEMKQEENLSVPFEMTTSEHIQDEPGTND
GSTEAAITLLTMGDLVLQSEISSEQGDVGVCIIPHVHSKDKSHIPSSLDNVNHKIVHECQ
ELSSPVITTSPASFEENKIVLEEQSSREEISLMEKVKENATPTRNTISKVTSNLRIRSRL
AKPKPNLEKTLGTNRLDDYQEVSSLCVTKGAEMETQRETEKNASKATELENKNLGPVTTA
ENKDQSKLACVHGIKGTSISSEVNLTERNENQEESSQEVHMLSVAPVASSETGPCTLGLD
RGLGENSVEEPQIKDSKGDSVLTLPVPEYTPTSIPEVQQENIINPQDLTVNLVANVPQDG
EDEQAFILTLVEIPANAVEEFTDATAQFMPNPLLPAPILVKSVNTEERGDMSICLPATSV
GQDAMGLSISGRDNSKKPPDNLDLVSRKRFQCRLDKNDHIPPAKKRSLTLRDDCQEYTTE
VHSKELTNVFEETGESHKGQDIFLTSGSTLTTPEPQRQQVEAAFQSRGSRSPDACMDKNV
PQLPQDEMIVSDKEERTDAAPKSQQMDSRTSSSKASLSRPGRRPLGFLSLICSKNSLESD
EPMQVHSKKRLKPLIPGLRKKLKRSNPFNESQEKNRESSDLLPSPSVITTQSENISSSAT
QVSCDQPLLKEGYKSAQKRAPQGEATTVSEYFFNDIFIEVDETE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6H8Y1	0.999	0.999	0.000	2624	1.000	1.000	A6H8Y1.pdb.gz	BDP1_HUMAN Transcription factor TFIIIB component B'' homolog OS=Homo sapiens OX=9606 GN=BDP1 PE=1 SV=3
2	PDB:6cnbS	0.032	0.330	2.338E-6	217	0.019	0.230	6cnbS.pdb.gz	Structural visualization of RNA polymerase III transcription machineries.
3	PDB:6f40W	0.034	0.323	1.273E-5	218	0.019	0.225	6f40W.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
4	PDB:6eu0V	0.032	0.254	1.076E-4	273	0.015	0.147	6eu0V.pdb.gz	Structural basis of RNA polymerase III transcription initiation.
5	AFDB:Q9Y618	0.031	0.032	2.677E-4	2514	0.127	0.133	Q9Y618.pdb.gz	NCOR2_HUMAN Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3
6	AFDB:D3ZXN9	0.038	0.040	3.441E-4	2472	0.124	0.132	D3ZXN9.pdb.gz	D3ZXN9_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=2
7	PDB:6f44W	0.033	0.393	2.058E-3	172	0.016	0.238	6f44W.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
8	AFDB:A0A2R8Q4C2	0.033	0.035	3.298E-3	2404	0.122	0.134	A0A2R8Q4C2.pdb.gz
9	AFDB:E7FF48	0.031	0.033	1.158E-2	2315	0.113	0.128	E7FF48.pdb.gz	E7FF48_DANRE Nuclear receptor corepressor 2 OS=Danio rerio OX=7955 GN=SMRT PE=1 SV=2
10	AFDB:O46048	0.032	0.027	3.583E-2	2342	0.132	0.148	O46048.pdb.gz	O46048_DROME EG:133E12.4 protein OS=Drosophila melanogaster OX=7227 GN=east PE=1 SV=1
11	AFDB:A2A884	0.028	0.028	4.063E-2	2348	0.134	0.150	A2A884.pdb.gz	ZEP3_MOUSE Transcription factor HIVEP3 OS=Mus musculus OX=10090 GN=Hivep3 PE=1 SV=1
12	AFDB:P31629	0.035	0.037	8.629E-2	2446	0.141	0.151	P31629.pdb.gz	ZEP2_HUMAN Transcription factor HIVEP2 OS=Homo sapiens OX=9606 GN=HIVEP2 PE=1 SV=2
13	PDB:4czzB	0.021	0.375	8.896E-2	133	0.005	0.090	4czzB.pdb.gz	Differential Properties of Transcriptional Complexes Formed by the Corest Family.
14	PDB:5l3cB	0.022	0.378	1.565E-1	134	0.007	0.142	5l3cB.pdb.gz	LSD1/KDM1A mutations associated to a newly described form of intellectual disability impair demethylase activity and binding to transcription factors.
15	AFDB:Q96L73	0.025	0.026	1.617E-1	2696	0.132	0.129	Q96L73.pdb.gz	NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1
16	AFDB:Q9VRM6	0.029	0.035	2.844E-1	1929	0.094	0.128	Q9VRM6.pdb.gz	Q9VRM6_DROME Lethal (3) persistent salivary gland 2 OS=Drosophila melanogaster OX=7227 GN=l(3)psg2 PE=4 SV=2
17	PDB:5lqwW	0.017	0.281	4.274E-1	128	0.005	0.102	5lqwW.pdb.gz	Molecular architecture of the Saccharomyces cerevisiae activated spliceosome
18	PDB:5mrc66	0.019	0.087	5.159E-1	305	0.008	0.072	5mrc66.pdb.gz	The structure of the yeast mitochondrial ribosome.
19	PDB:6k15D	0.017	0.128	1.096	305	0.009	0.079	6k15D.pdb.gz	Structure of the RSC complex bound to the nucleosome.
20	PDB:6j6gc	0.018	0.103	1.597	436	0.006	0.037	6j6gc.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRX7	0.0	1719	846	0.320	0.992	A0A0A0MRX7_HUMAN Transcription factor TFIIIB component B'' homolog OS=Homo sapiens OX=9606 GN=BDP1 PE=1 SV=1
2	A6H8Y1	0.0	5315	2624	1.000	1.000	BDP1_HUMAN Transcription factor TFIIIB component B'' homolog OS=Homo sapiens OX=9606 GN=BDP1 PE=1 SV=3
3	Q9VJZ3	1.15e-20	102	695	0.024	0.091	Q9VJZ3_DROME B double prime 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Bdp1 PE=2 SV=2
4	P46678	1.13e-14	82.4	594	0.018	0.077	TFC5_YEAST Transcription factor TFIIIB component B'' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BDP1 PE=1 SV=1
5	O94481	1.41e-13	78.6	520	0.019	0.094	TFC5_SCHPO Transcription factor TFIIIB component B'' OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bdp1 PE=3 SV=2
6	Q54R53	4.73e-10	67.0	457	0.014	0.079	Q54R53_DICDI Myb domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=bdp1 PE=4 SV=1
7	Q38AI0	0.098	40.0	298	0.010	0.084	Q38AI0_TRYB2 Transcription factor TFIIIB component B'' Myb domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2730 PE=4 SV=1
8	A0JNT9	9.1	33.9	577	0.018	0.083	BICL1_MOUSE BICD family-like cargo adapter 1 OS=Mus musculus OX=10090 GN=Bicdl1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11142 DUF2917	2.2e+02	12.6	Protein of unknown function (DUF2917)
2	PF00249 Myb_DNA-binding	3.2e+02	12.9	Myb-like DNA-binding domain
3	PF15963 Myb_DNA-bind_7	3e-23	92.7	Myb DNA-binding like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351575

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348510	0.999	General transcription factor 3C polypeptide 1
2	9606.ENSP00000375942	0.999	TATA-box-binding protein
3	9606.ENSP00000448323	0.999	Transcription factor IIIB 90 kDa subunit
4	9606.ENSP00000220659	0.998	Transcription factor IIIB 50 kDa subunit
5	9606.ENSP00000263956	0.995	General transcription factor 3C polypeptide 3
6	9606.ENSP00000366828	0.992	DNA-directed RNA polymerase III subunit RPC6
7	9606.ENSP00000370532	0.992	Transcription factor IIIA
8	9606.ENSP00000361446	0.986	DNA-directed RNA polymerase III subunit RPC1
9	9606.ENSP00000361180	0.984	General transcription factor 3C polypeptide 5
10	9606.ENSP00000334564	0.962	DNA-directed RNA polymerase III subunit RPC3
11	9606.ENSP00000299853	0.961	DNA-directed RNA polymerase III subunit RPC5
12	9606.ENSP00000269305	0.959	Cellular tumor antigen p53
13	9606.ENSP00000479618	0.959	Myc proto-oncogene protein
14	9606.ENSP00000228347	0.956	DNA-directed RNA polymerase III subunit RPC2
15	9606.ENSP00000302478	0.955	DNA-directed RNA polymerases I and III subunit RPAC2
16	9606.ENSP00000247219	0.944	TATA box-binding protein-like protein 2
17	9606.ENSP00000380904	0.944	DNA-directed RNA polymerase III subunit RPC4
18	9606.ENSP00000361219	0.943	General transcription factor 3C polypeptide 4
19	9606.ENSP00000359531	0.939	Transcription initiation factor IIB
20	9606.ENSP00000378736	0.932	DNA-directed RNA polymerase III subunit RPC9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.537	heterocyclic compound binding
GO:0097159	0.537	organic cyclic compound binding
GO:0003676	0.451	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050789	0.983	regulation of biological process
GO:0050794	0.937	regulation of cellular process
GO:0008152	0.868	metabolic process
GO:0071840	0.813	cellular component organization or biogenesis
GO:0016043	0.802	cellular component organization
GO:0071704	0.800	organic substance metabolic process
GO:0060255	0.780	regulation of macromolecule metabolic process
GO:0044237	0.763	cellular metabolic process
GO:0044238	0.757	primary metabolic process
GO:0043170	0.757	macromolecule metabolic process
GO:0051171	0.727	regulation of nitrogen compound metabolic process
GO:0006807	0.726	nitrogen compound metabolic process
GO:1901360	0.719	organic cyclic compound metabolic process
GO:0046483	0.719	heterocycle metabolic process
GO:0080090	0.717	regulation of primary metabolic process
GO:0006725	0.716	cellular aromatic compound metabolic process
GO:0034641	0.715	cellular nitrogen compound metabolic process
GO:0031323	0.707	regulation of cellular metabolic process
GO:0090304	0.695	nucleic acid metabolic process
GO:0010468	0.652	regulation of gene expression
GO:0019219	0.620	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.361	positive regulation of biological process
GO:0019438	0.349	aromatic compound biosynthetic process
GO:0018130	0.348	heterocycle biosynthetic process
GO:1901362	0.347	organic cyclic compound biosynthetic process
GO:0010467	0.319	gene expression
GO:0010556	0.317	regulation of macromolecule biosynthetic process
GO:0034654	0.316	nucleobase-containing compound biosynthetic process
GO:0097659	0.312	nucleic acid-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.711	cytoplasm
GO:0032991	0.592	protein-containing complex
GO:0005829	0.443	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]