StarFunc result for job id A6NC86

User Input

>input (204 residues)
MRLSRRPETFLLAFVLLCTLLGLGCPLHCEICTAAGSRCHGQMKTCSSDKDTCVLLVGKA
TSKGKELVHTYKGCIRSQDCYSGVISTTMGPKDHMVTSSFCCQSDGCNSAFLSVPLTNLT
ENGLMCPACTASFRDKCMGPMTHCTGKENHCVSLSGHVQAGIFKPRFAMRGCATESMCFT
KPGAEVPTGTNVLFLHHIECTHSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O55006	0.664	0.576	3.005E-10	240	0.230	0.196	O55006.pdb.gz	ROB1_RAT Protein RoBo-1 OS=Rattus norvegicus OX=10116 PE=1 SV=1
2	AFDB:Q6YI28	0.601	0.564	6.134E-10	220	0.250	0.232	Q6YI28.pdb.gz	Q6YI28_MOUSE EP1 OS=Mus musculus OX=10090 GN=Lypd8l PE=1 SV=1
3	AFDB:Q5NC41	0.605	0.537	2.084E-9	235	0.216	0.187	Q5NC41.pdb.gz	Q5NC41_MOUSE RIKEN cDNA 1810065E05 gene OS=Mus musculus OX=10090 GN=1810065E05Rik PE=1 SV=1
4	AFDB:Q6UX82	0.589	0.522	4.954E-9	237	0.181	0.156	Q6UX82.pdb.gz	LYPD8_HUMAN Ly6/PLAUR domain-containing protein 8 OS=Homo sapiens OX=9606 GN=LYPD8 PE=1 SV=2
5	AFDB:P35456	0.387	0.275	2.285E-8	327	0.221	0.138	P35456.pdb.gz	UPAR_MOUSE Urokinase plasminogen activator surface receptor OS=Mus musculus OX=10090 GN=Plaur PE=1 SV=1
6	AFDB:Q924B5	0.428	0.366	4.907E-8	250	0.196	0.160	Q924B5.pdb.gz	TX101_RAT Testis-expressed protein 101 OS=Rattus norvegicus OX=10116 GN=Tex101 PE=1 SV=1
7	AFDB:Q9D7S0	0.616	0.513	1.001E-7	255	0.206	0.165	Q9D7S0.pdb.gz	LYPD8_MOUSE Ly6/PLAUR domain-containing protein 8 OS=Mus musculus OX=10090 GN=Lypd8 PE=1 SV=1
8	AFDB:O55162	0.368	0.239	1.054E-7	352	0.211	0.122	O55162.pdb.gz	LYPD3_RAT Ly6/PLAUR domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Lypd3 PE=1 SV=1
9	AFDB:P49616	0.393	0.277	1.846E-7	328	0.206	0.128	P49616.pdb.gz	UPAR_RAT Urokinase plasminogen activator surface receptor OS=Rattus norvegicus OX=10116 GN=Plaur PE=2 SV=2
10	AFDB:Q9JMI7	0.389	0.344	3.072E-7	250	0.191	0.156	Q9JMI7.pdb.gz	TX101_MOUSE Testis-expressed protein 101 OS=Mus musculus OX=10090 GN=Tex101 PE=1 SV=1
11	PDB:3laqV	0.365	0.302	1.077E-5	260	0.206	0.162	3laqV.pdb.gz
12	PDB:3bt1U	0.470	0.371	4.720E-5	273	0.147	0.110	3bt1U.pdb.gz
13	PDB:2n99A	0.266	0.639	2.364E-2	76	0.098	0.263	2n99A.pdb.gz
14	PDB:5c7kF	0.091	0.088	9.847E-2	212	0.108	0.104	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
15	PDB:5viyI	0.102	0.101	1.337E-1	213	0.098	0.094	5viyI.pdb.gz	Asymmetric recognition of HIV-1 Envelope trimer by V1V2 loop-targeting antibodies.
16	PDB:3vtsA	0.219	0.689	1.558E-1	61	0.078	0.262	3vtsA.pdb.gz
17	PDB:6wjcC	0.254	0.688	1.910E-1	69	0.054	0.159	6wjcC.pdb.gz	Structure and selectivity engineering of the M1muscarinic receptor toxin complex.
18	PDB:5esvL	0.092	0.090	2.010E-1	214	0.108	0.103	5esvL.pdb.gz	Structures of HIV-1 Env V1V2 with broadly neutralizing antibodies reveal commonalities that enable vaccine design.
19	PDB:4zqyA	0.212	0.577	2.115E-1	65	0.064	0.200	4zqyA.pdb.gz
20	PDB:6sgaFS	0.095	0.074	2.464E-1	277	0.064	0.047	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8VE86	1.66e-07	52.0	220	0.235	0.218	Q8VE86_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Lypd8l PE=2 SV=1
2	Q6YI28	1.18e-06	49.7	220	0.230	0.214	Q6YI28_MOUSE EP1 OS=Mus musculus OX=10090 GN=Lypd8l PE=1 SV=1
3	O55006	5.57e-06	47.8	240	0.186	0.158	ROB1_RAT Protein RoBo-1 OS=Rattus norvegicus OX=10116 PE=1 SV=1
4	Q05588	1.86e-05	46.6	330	0.221	0.136	UPAR_BOVIN Urokinase plasminogen activator surface receptor OS=Bos taurus OX=9913 GN=PLAUR PE=2 SV=1
5	Q5NC41	0.001	40.8	235	0.162	0.140	Q5NC41_MOUSE RIKEN cDNA 1810065E05 gene OS=Mus musculus OX=10090 GN=1810065E05Rik PE=1 SV=1
6	Q9D8K1	0.001	40.8	235	0.162	0.140	Q9D8K1_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=1810065E05Rik PE=2 SV=1
7	Q8R0G1	0.002	40.4	235	0.162	0.140	Q8R0G1_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=1810065E05Rik PE=2 SV=1
8	Q6UX82	0.006	38.9	237	0.142	0.122	LYPD8_HUMAN Ly6/PLAUR domain-containing protein 8 OS=Homo sapiens OX=9606 GN=LYPD8 PE=1 SV=2
9	Q03405	0.010	38.5	335	0.137	0.084	UPAR_HUMAN Urokinase plasminogen activator surface receptor OS=Homo sapiens OX=9606 GN=PLAUR PE=1 SV=1
10	E7F2M5	0.017	36.2	118	0.176	0.305	E7F2M5_DANRE CD59 molecule (CD59 blood group) OS=Danio rerio OX=7955 GN=fj38b04 PE=1 SV=1
11	P27274	0.055	35.0	126	0.137	0.222	CD59_RAT CD59 glycoprotein OS=Rattus norvegicus OX=10116 GN=Cd59 PE=1 SV=2
12	Q12287	0.17	32.3	69	0.054	0.159	COX17_YEAST Cytochrome c oxidase copper chaperone OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX17 PE=1 SV=3
13	Q9D7S0	0.26	33.9	255	0.245	0.196	LYPD8_MOUSE Ly6/PLAUR domain-containing protein 8 OS=Mus musculus OX=10090 GN=Lypd8 PE=1 SV=1
14	Q8N6Q3	0.27	34.3	437	0.147	0.069	CD177_HUMAN CD177 antigen OS=Homo sapiens OX=9606 GN=CD177 PE=1 SV=2
15	Q9SRU2	0.52	33.5	5098	0.167	0.007	BIG_ARATH Auxin transport protein BIG OS=Arabidopsis thaliana OX=3702 GN=BIG PE=1 SV=2
16	Q0VGV1	0.95	32.7	1540	0.142	0.019	Q0VGV1_MOUSE Gli2 protein OS=Mus musculus OX=10090 GN=Gli2 PE=2 SV=1
17	Q0VGT2	0.97	32.7	1544	0.142	0.019	GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus OX=10090 GN=Gli2 PE=1 SV=2
18	P39933	2.4	31.2	429	0.093	0.044	TF3A_YEAST Transcription factor IIIA OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PZF1 PE=1 SV=1
19	Q6UWN0	2.8	30.8	246	0.172	0.142	LYPD4_HUMAN Ly6/PLAUR domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LYPD4 PE=2 SV=2
20	F1M2B7	2.9	31.2	1544	0.137	0.018	F1M2B7_RAT GLI family zinc finger 2 OS=Rattus norvegicus OX=10116 GN=Gli2 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05051 COX17	7.8	18.3	Cytochrome C oxidase copper chaperone (COX17)
2	PF03391 Nepo_coat	4.2e+02	11.8	Nepovirus coat protein, central domain
3	PF18672 PilZN1	6.4e+02	11.5	N-terminal PilZ-like domain PilZN1
4	PF02988 PLA2_inh	1.2e-05	37.2	Phospholipase A2 inhibitor
5	PF08117 Toxin_30	1.2e+02	14.4	Ptu family
6	PF00021 UPAR_LY6	3.3e-08	45.4	u-PAR/Ly-6 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479240

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000292147	0.718	Persulfide dioxygenase ETHE1, mitochondrial
2	9606.ENSP00000455811	0.707	Lymphocyte antigen 6L
3	9606.ENSP00000367185	0.700	LY6/PLAUR domain containing 5
4	9606.ENSP00000395505	0.682	Prostate and testis expressed 3
5	9606.ENSP00000411439	0.661	Prostate and testis expressed protein 4
6	9606.ENSP00000472308	0.652	Testis-expressed protein 101
7	9606.ENSP00000244333	0.645	Ly6/PLAUR domain-containing protein 3
8	9606.ENSP00000351325	0.644	Prostate and testis expressed 2
9	9606.ENSP00000307164	0.638	Prostate and testis expressed 1
10	9606.ENSP00000476510	0.623	LY6/PLAUR domain containing 4
11	9606.ENSP00000365024	0.617	Lymphocyte antigen 6 family member G5B
12	9606.ENSP00000372724	0.612	Lymphocyte antigen 6 complex locus protein G5c
13	9606.ENSP00000312774	0.608	Sperm acrosome membrane-associated protein 4
14	9606.ENSP00000352163	0.602	LY6/PLAUR domain containing 2
15	9606.ENSP00000364978	0.594	Lymphocyte antigen 6 family member G6C
16	9606.ENSP00000483570	0.574	Tyrosine-protein kinase BTK
17	9606.ENSP00000372910	0.572	Lymphocyte antigen 6 family member G6E
18	9606.ENSP00000475702	0.572	Lymphocyte antigen 6 family member G6E
19	9606.ENSP00000399485	0.567	Lymphocyte antigen 6H
20	9606.ENSP00000364992	0.565	Lymphocyte antigen 6 complex locus protein G6f

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.639	molecular function regulator activity
GO:0030545	0.483	signaling receptor regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.976	response to stimulus
GO:0050789	0.887	regulation of biological process
GO:0050794	0.830	regulation of cellular process
GO:0009987	0.787	cellular process
GO:0009605	0.335	response to external stimulus
GO:0044419	0.319	biological process involved in interspecies interaction between organisms
GO:0009607	0.316	response to biotic stimulus
GO:0051707	0.309	response to other organism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005886	0.966	plasma membrane
GO:0043227	0.405	membrane-bounded organelle
GO:0043229	0.389	intracellular organelle
GO:0005737	0.374	cytoplasm
GO:0043231	0.331	intracellular membrane-bounded organelle
GO:0031982	0.320	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]