StarFunc result for job id A6NC98

User Input

>input (1476 residues)
MEGGKGPRLRDFLSGSLATWALGLAGLVGEAEDSEGEEEEEEEEPPLWLEKRFLRLSDGA
LLLRVLGIIAPSSRGGPRMLRGLDGPAAWRVWNLNHLWGRLRDFYQEELQLLILSPPPDL
QTLGFDPLSEEAVEQLEGVLRLLLGASVQCEHRELFIRHIQGLSLEVQSELAAAIQEVTQ
PGAGVVLALSGPDPGELAPAELEMLSRSLMGTLSKLARERDLGAQRLAELLLEREPLCLR
PEAPSRAPAEGPSHHLALQLANAKAQLRRLRQELEEKAELLLDSQAEVQGLEAEIRRLRQ
EAQALSGQAKRAELYREEAEALRERAGRLPRLQEELRRCRERLQAAEAYKSQLEEERVLS
GVLEASKALLEEQLEAARERCARLHETQRENLLLRTRLGEAHAELDSLRHQVDQLAEENV
ELELELQRSLEPPPGSPGEAPLAGAAPSLQDEVREAEAGRLRTLERENRELRGLLQVLQG
QPGGQHPLLEAPREDPVLPVLEEAPQTPVAFDHSPQGLVQKARDGGPQALDLAPPALDSV
LEASAECPQAPDSDPQEAESPLQAAAMDPQASDWSPQESGSPVETQESPEKAGRRSSLQS
PASVAPPQGPGTKIQAPQLLGGETEGREAPQGELVPEAWGLRQEGPEHKPGPSEPSSVQL
EEQEGPNQGLDLATGQAEAREHDQRLEGTVRDPAWQKPQQKSEGALEVQVWEGPIPGESL
ASGVAEQEALREEVAQLRRKAEALGDELEAQARKLEAQNTEAARLSKELAQARRAEAEAH
REAEAQAWEQARLREAVEAAGQELESASQEREALVEALAAAGRERRQWEREGSRLRAQSE
AAEERMQVLESEGRQHLEEAERERREKEALQAELEKAVVRGKELGDRLEHLQRELEQAAL
ERQEFLREKESQHQRYQGLEQRLEAELQAAATSKEEALMELKTRALQLEEELFQLRQGPA
GLGPKKRAEPQLVETQNVRLIEVERSNAMLVAEKAALQGQLQHLEGQLGSLQGRAQELLL
QSQRAQEHSSRLQAEKSVLEIQGQELHRKLEVLEEEVRAARQSQEETRGQQQALLRDHKA
LAQLQRRQEAELEGLLVRHRDLKANMRALELAHRELQGRHEQLQAQRASVEAQEVALLAE
RERLMQDGHRQRGLEEELRRLQSEHDRAQMLLAELSRERGELQGERGELRGRLARLELER
AQLEMQSQQLRESNQQLDLSACRLTTQCELLTQLRSAQEEENRQLLAEVQALSRENRELL
ERSLESRDHLHREQREYLDQLNALRREKQKLVEKIMDQYRVLEPVPLPRTKKGSWLADKV
KRLMRPRREGGPPGGLRLGADGAGSTESLGGPPETELPEGREADGTGSPSPAPMRRAQSS
LCLRDETLAGGQRRKLSSRFPVGRSSESFSPGDTPRQRFRQRHPGPLGAPVSHSKGPGVG
WENSAETLQEHETDANREGPEVQEPEKRPLTPSLSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NC98	1.000	1.000	0.000	1476	1.000	1.000	A6NC98.pdb.gz	CC88B_HUMAN Coiled-coil domain-containing protein 88B OS=Homo sapiens OX=9606 GN=CCDC88B PE=1 SV=1
2	AFDB:Q4QRL3	0.335	0.334	0.000	1481	0.781	0.779	Q4QRL3.pdb.gz	CC88B_MOUSE Coiled-coil domain-containing protein 88B OS=Mus musculus OX=10090 GN=Ccdc88b PE=1 SV=2
3	AFDB:Q6VGS5	0.158	0.125	3.038E-28	2009	0.289	0.212	Q6VGS5.pdb.gz	DAPLE_MOUSE Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1
4	AFDB:Q5SNZ0	0.185	0.151	1.357E-26	1873	0.272	0.214	Q5SNZ0.pdb.gz	GRDN_MOUSE Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV=2
5	AFDB:A0A2R8QCI3	0.192	0.149	5.066E-24	2023	0.288	0.210	A0A2R8QCI3.pdb.gz	DAPLE_DANRE Protein Daple OS=Danio rerio OX=7955 GN=ccdc88c PE=2 SV=1
6	AFDB:Q8INC1	0.080	0.102	4.940E-3	1134	0.129	0.168	Q8INC1.pdb.gz	Q8INC1_DROME Myosin heavy chain-like, isoform D OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=4 SV=1
7	AFDB:Q7Z6P3	0.059	0.077	5.524E-3	1021	0.092	0.133	Q7Z6P3.pdb.gz	RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens OX=9606 GN=RAB44 PE=1 SV=4
8	AFDB:F1LP90	0.056	0.061	1.277E-2	1336	0.083	0.091	F1LP90.pdb.gz	MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus OX=10116 GN=Mink1 PE=1 SV=2
9	AFDB:A0A0B4KGR6	0.080	0.103	2.361E-2	1113	0.140	0.186	A0A0B4KGR6.pdb.gz	A0A0B4KGR6_DROME Myosin heavy chain-like, isoform I OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=4 SV=1
10	AFDB:Q1ZXE2	0.071	0.084	2.952E-2	1211	0.081	0.098	Q1ZXE2.pdb.gz	Y7875_DICDI PH domain-containing protein DDB_G0287875 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0287875 PE=2 SV=1
11	PDB:5x3xQ	0.053	0.157	2.094E-1	243	0.027	0.165	5x3xQ.pdb.gz
12	PDB:3r2qA	0.037	0.159	3.462E-1	202	0.015	0.109	3r2qA.pdb.gz	Structural and Functional Genomics of YibF, a Glutathione Transferase Homologue from Escherichia coli
13	PDB:7nacI	0.046	0.096	8.003E-1	533	0.023	0.064	7nacI.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
14	PDB:7f02B	0.044	0.171	9.464E-1	220	0.026	0.173	7f02B.pdb.gz	Structures of the CcmABCD heme release complex at multiple states.
15	PDB:3ipmO	0.043	0.183	1.001	219	0.020	0.132	3ipmO.pdb.gz
16	PDB:6vaeA	0.044	0.052	1.058	1198	0.014	0.018	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
17	PDB:7pntV	0.048	0.123	1.119	365	0.030	0.121	7pntV.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
18	PDB:7ay1A	0.042	0.055	1.183	1033	0.018	0.026	7ay1A.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
19	PDB:7sj9M	0.048	0.369	1.251	131	0.008	0.092	7sj9M.pdb.gz	Structural transitions in the GTP cap visualized by cryo-electron microscopy of catalytically inactive microtubules.
20	PDB:6zmwu	0.049	0.081	1.323	706	0.047	0.099	6zmwu.pdb.gz	Structure of a human 48Stranslational initiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NC98	0.0	2797	1476	1.000	1.000	CC88B_HUMAN Coiled-coil domain-containing protein 88B OS=Homo sapiens OX=9606 GN=CCDC88B PE=1 SV=1
2	Q4QRL3	0.0	1969	1481	0.784	0.781	CC88B_MOUSE Coiled-coil domain-containing protein 88B OS=Mus musculus OX=10090 GN=Ccdc88b PE=1 SV=2
3	Q5SNZ0	1.50e-68	258	1873	0.120	0.095	GRDN_MOUSE Girdin OS=Mus musculus OX=10090 GN=Ccdc88a PE=1 SV=2
4	Q3V6T2	1.03e-66	252	1871	0.138	0.109	GRDN_HUMAN Girdin OS=Homo sapiens OX=9606 GN=CCDC88A PE=1 SV=2
5	A0A8I5ZW24	2.12e-66	251	1845	0.144	0.115	A0A8I5ZW24_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=4 SV=1
6	D3ZYD7	3.49e-66	249	1523	0.142	0.137	D3ZYD7_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=1 SV=4
7	A0A8I6A5W7	3.96e-66	250	1873	0.142	0.112	A0A8I6A5W7_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=4 SV=1
8	Q6VGS5	2.42e-64	244	2009	0.112	0.083	DAPLE_MOUSE Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1
9	Q9P219	2.47e-64	244	2028	0.112	0.082	DAPLE_HUMAN Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3
10	P85120	4.82e-63	240	2058	0.113	0.081	DAPLE_XENLA Protein Daple OS=Xenopus laevis OX=8355 GN=ccdc88c PE=1 SV=1
11	A0A2R8QCI3	1.76e-61	235	2023	0.113	0.083	DAPLE_DANRE Protein Daple OS=Danio rerio OX=7955 GN=ccdc88c PE=2 SV=1
12	Q9VZT7	6.44e-40	164	1381	0.100	0.107	Q9VZT7_DROME Girdin, isoform A OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
13	M9PE55	7.48e-40	164	1346	0.100	0.110	M9PE55_DROME Girdin, isoform E OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
14	M9PDY5	8.31e-40	164	1380	0.100	0.107	M9PDY5_DROME Girdin, isoform C OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
15	M9PEG0	1.65e-39	163	1236	0.100	0.120	M9PEG0_DROME Girdin, isoform D OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
16	Q8SX64	1.82e-39	163	1235	0.100	0.120	Q8SX64_DROME Girdin, isoform B OS=Drosophila melanogaster OX=7227 GN=Girdin PE=1 SV=1
17	F3Y5P4	7.17e-17	89.4	1319	0.072	0.081	GRDN_CAEEL Girdin homolog OS=Caenorhabditis elegans OX=6239 GN=grdn-1 PE=1 SV=1
18	Q24185	2.62e-06	54.7	679	0.070	0.152	HOOK_DROME Protein hook OS=Drosophila melanogaster OX=7227 GN=hook PE=1 SV=2
19	Q86VS8	5.06e-04	47.0	718	0.064	0.132	HOOK3_HUMAN Protein Hook homolog 3 OS=Homo sapiens OX=9606 GN=HOOK3 PE=1 SV=2
20	Q8BIL5	0.002	45.4	728	0.064	0.130	HOOK1_MOUSE Protein Hook homolog 1 OS=Mus musculus OX=10090 GN=Hook1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19047 HOOK_N	0.0024	29.0	HOOK domain
2	PF12325 TMF_TATA_bd	20	16.7	TATA element modulatory factor 1 TATA binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349238

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324173	0.707	78 kDa glucose-regulated protein
2	9606.ENSP00000360252	0.651	Protein Hook homolog 1
3	9606.ENSP00000358867	0.624	Guanine nucleotide-binding protein G(k) subunit alpha
4	9606.ENSP00000249923	0.539	Coatomer subunit beta
5	9606.ENSP00000394888	0.535	Dedicator of cytokinesis protein 8
6	9606.ENSP00000391747	0.522	Laccase domain-containing protein 1
7	9606.ENSP00000329140	0.516	Cyclic AMP-responsive element-binding protein 3-like protein 2
8	9606.ENSP00000407763	0.507	Coiled-coil domain containing 122

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050794	0.991	regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0048522	0.965	positive regulation of cellular process
GO:0009893	0.937	positive regulation of metabolic process
GO:0060255	0.925	regulation of macromolecule metabolic process
GO:0009987	0.904	cellular process
GO:0051239	0.878	regulation of multicellular organismal process
GO:0010604	0.824	positive regulation of macromolecule metabolic process
GO:0002682	0.789	regulation of immune system process
GO:0010468	0.784	regulation of gene expression
GO:0050865	0.779	regulation of cell activation
GO:0002694	0.628	regulation of leukocyte activation
GO:0002684	0.523	positive regulation of immune system process
GO:0042127	0.479	regulation of cell population proliferation
GO:0051240	0.470	positive regulation of multicellular organismal process
GO:0051249	0.406	regulation of lymphocyte activation
GO:0006950	0.403	response to stress
GO:0002696	0.402	positive regulation of leukocyte activation
GO:0051716	0.384	cellular response to stimulus
GO:0045785	0.384	positive regulation of cell adhesion
GO:0070663	0.369	regulation of leukocyte proliferation
GO:0032944	0.349	regulation of mononuclear cell proliferation
GO:0009605	0.338	response to external stimulus
GO:0010628	0.327	positive regulation of gene expression
GO:0051179	0.317	localization
GO:0044419	0.305	biological process involved in interspecies interaction between organisms

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:0043228	0.998	non-membrane-bounded organelle
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005829	0.994	cytosol
GO:0070013	0.994	intracellular organelle lumen
GO:0005634	0.990	nucleus
GO:0005813	0.985	centrosome
GO:0031981	0.980	nuclear lumen
GO:0005654	0.965	nucleoplasm
GO:0012505	0.928	endomembrane system
GO:0071944	0.565	cell periphery
GO:0005886	0.393	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]