StarFunc result for job id A6NCI4

User Input

>input (1184 residues)
MKKYRKISIGCFAMATQTSHVFHGQENMFLENHCIRRNTGRDSKKPLKQKNMNGLGQNSD
NGLLVTHVNQTQDLLRLQGSETQSSDWEDSEDWLSAHSLKCQKLTLADLISQGTEVLEEG
TNVVQKICFSTQIIRHFESKLSDTIEVYQERIQWLTENSKKAFGLIKGARVSILIDVSAI
SSGPQKEEFQKDLMSLIDEQLSHKEKLFVLSFGTNAGSLWPDPMEVSASTLQELKLWVKT
LQPDGGSNLLQALKKIFTLKGLDSLVAIMRSCPDQPSEILSDYIQQSTMGRDLIIHFITY
RCDDQMPPAVLKNLAEAVRGYYHCYSPKMEHYTSRDMDELLAEIQKAQSLLSHVQALQHS
SPCEALTCTMEEISTEITNGPLISLLPKPPKHDAPLTIEFPNLDKTSAEWLKVNGLKAKK
LSLYQVLAPNAFSPVEEFVPILQKTVSSTIHEKAMIQFEWHDGTVKNIHVDPPFLYKYQQ
QLSRAMRMYERRIEWLSLASRRIWGTVCEKRVVVLLDISATNSMYIIHIQHSLRLLLEEQ
LSNKDCFNLIAFGSTIESWRPEMVPVSHNNLQSAWRWALNLRCRGSRNVLSALRKAVEVD
FKDKDKHQSQGIYLFTGGIPDQDMPTLSAYMAEACGGCDLQLNVCLFYVGEPKMDTTPPA
RYASHTDTAAAYKEVTRAAGGRFHWFGDTGIYESDDINSIMSEMEKALNYSQKCAFLMAS
LKNHSGKVLGSSALPKEKPKTLQLRSQPKKLCPPRPTVPLGARMSIKDDPDREKSPPLKS
LKWRPLSSRVGISPAAAQPTKEGMMELRRKTKSREAETSLLLFYTEKGNDVGSVYKKYPQ
GRGLRRTSSSIDLPRKDTVCSSQEWVAKYGLKKLKLEISRCMGPNCTHQKSGQRSASAKH
CSIFPSVEIHGVVRHIQWTPREMEVYIRHLEKVLRRYVQRLQWLLSGSRRLFGTVLESKV
CILLDTSGSMGPYLQQVKTELVLLIWEQLRKCCDSFNLLSFAESFQSWQDTLVETTDAAC
HEAMQWVTHLQAQGSTSILQALLKAFSFHDLEGLYLLTDGKPDTSCSLVLNEVQKLREKR
DVKVHTISLNCSDRAAVEFLRKLASFTGGRYHCPVGEDTLSKIHSLLTKGFINEKDPTLP
PFEGDDLRILAQEITKARSFLWQAQSFRSQLQKKNDAEPKVTLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q502W6	0.227	0.209	3.745E-46	1294	0.174	0.159	Q502W6.pdb.gz	VWA3B_HUMAN von Willebrand factor A domain-containing protein 3B OS=Homo sapiens OX=9606 GN=VWA3B PE=1 SV=3
2	AFDB:Q6UXX5	0.120	0.109	4.549E-7	1313	0.056	0.050	Q6UXX5.pdb.gz	ITIH6_HUMAN Inter-alpha-trypsin inhibitor heavy chain H6 OS=Homo sapiens OX=9606 GN=ITIH6 PE=1 SV=1
3	PDB:6jp8F	0.128	0.153	7.466E-6	973	0.035	0.043	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
4	PDB:4nehA	0.113	0.123	3.915E-5	1084	0.027	0.030	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
5	AFDB:Q2UY11	0.128	0.132	1.354E-4	1141	0.051	0.053	Q2UY11.pdb.gz	COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus OX=10090 GN=Col28a1 PE=2 SV=1
6	PDB:4nenA	0.119	0.132	1.357E-4	1063	0.029	0.032	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
7	PDB:7zs96	0.115	0.316	2.525E-4	383	0.016	0.050	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
8	PDB:6zheC	0.099	0.157	3.629E-4	705	0.029	0.048	6zheC.pdb.gz	Dimers of DNA-PK create a stage for DNA double-strand break repair.
9	PDB:7ena2	0.114	0.325	4.464E-4	385	0.024	0.075	7ena2.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
10	PDB:7ad8D	0.109	0.410	5.214E-4	280	0.028	0.118	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
11	PDB:2xwbF	0.110	0.173	5.783E-4	714	0.034	0.056	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
12	PDB:6gym6	0.116	0.366	1.076E-3	335	0.019	0.066	6gym6.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
13	PDB:6kxkD	0.117	0.224	1.469E-3	553	0.030	0.065	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
14	AFDB:D3ZVD8	0.091	0.093	1.431E-2	1155	0.101	0.104	D3ZVD8.pdb.gz	D3ZVD8_RAT Histone deacetylase 6 OS=Rattus norvegicus OX=10116 GN=Hdac6 PE=1 SV=3
15	AFDB:Q7SZP5	0.074	0.122	2.401E-2	588	0.063	0.128	Q7SZP5.pdb.gz
16	AFDB:A7UDM2	0.060	0.071	3.633E-2	942	0.101	0.126	A7UDM2.pdb.gz	A7UDM2_MAIZE CFM2 (Fragment) OS=Zea mays OX=4577 GN=CFM2 PE=1 SV=1
17	AFDB:Q08817	0.071	0.095	5.790E-2	791	0.094	0.140	Q08817.pdb.gz	SOG2_YEAST Leucine-rich repeat-containing protein SOG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SOG2 PE=1 SV=1
18	AFDB:A0A0B4KF25	0.086	0.089	6.763E-2	1131	0.048	0.050	A0A0B4KF25.pdb.gz	A0A0B4KF25_DROME Reduction in Cnn dots 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
19	AFDB:O81283	0.077	0.065	8.320E-2	1503	0.057	0.045	O81283.pdb.gz	TC159_ARATH Translocase of chloroplast 159, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TOC159 PE=1 SV=1
20	AFDB:Q10988	0.069	0.113	9.718E-2	599	0.052	0.104	Q10988.pdb.gz	UVE1_SCHPO UV-damage endonuclease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uve1 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q502W6	3.42e-38	158	1294	0.124	0.114	VWA3B_HUMAN von Willebrand factor A domain-containing protein 3B OS=Homo sapiens OX=9606 GN=VWA3B PE=1 SV=3
2	H0YEM4	1.52e-10	67.8	723	0.035	0.057	H0YEM4_HUMAN von Willebrand factor A domain containing 3B (Fragment) OS=Homo sapiens OX=9606 GN=VWA3B PE=1 SV=1
3	A6X935	2.23e-08	61.2	942	0.040	0.050	ITIH4_MOUSE Inter alpha-trypsin inhibitor, heavy chain 4 OS=Mus musculus OX=10090 GN=Itih4 PE=1 SV=2
4	Q3T052	1.01e-07	58.9	916	0.041	0.053	ITIH4_BOVIN Inter-alpha-trypsin inhibitor heavy chain H4 OS=Bos taurus OX=9913 GN=ITIH4 PE=1 SV=1
5	Q14624	1.28e-07	58.5	930	0.031	0.040	ITIH4_HUMAN Inter-alpha-trypsin inhibitor heavy chain H4 OS=Homo sapiens OX=9606 GN=ITIH4 PE=1 SV=4
6	P19823	1.98e-07	58.2	946	0.036	0.045	ITIH2_HUMAN Inter-alpha-trypsin inhibitor heavy chain H2 OS=Homo sapiens OX=9606 GN=ITIH2 PE=1 SV=2
7	Q5EBC0	5.69e-07	56.6	933	0.038	0.048	Q5EBC0_RAT Inter-alpha-trypsin inhibitor heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Itih4 PE=4 SV=1
8	Q8BJD1	6.29e-07	56.2	952	0.040	0.049	ITIH5_MOUSE Inter-alpha-trypsin inhibitor heavy chain H5 OS=Mus musculus OX=10090 GN=Itih5 PE=1 SV=1
9	O35802	6.63e-07	56.2	932	0.038	0.048	O35802_RAT Inter-alpha-inhibitor H4 heavy chain OS=Rattus norvegicus OX=10116 GN=Itih4 PE=2 SV=1
10	D3ZFC6	7.39e-07	56.2	927	0.038	0.049	D3ZFC6_RAT Inter-alpha-trypsin inhibitor heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Itih4 PE=1 SV=4
11	Q86UX2	9.83e-07	55.8	942	0.037	0.047	ITIH5_HUMAN Inter-alpha-trypsin inhibitor heavy chain H5 OS=Homo sapiens OX=9606 GN=ITIH5 PE=2 SV=2
12	Q61703	1.77e-06	55.1	946	0.035	0.044	ITIH2_MOUSE Inter-alpha-trypsin inhibitor heavy chain H2 OS=Mus musculus OX=10090 GN=Itih2 PE=1 SV=1
13	Q6UXX5	2.14e-06	54.7	1313	0.038	0.034	ITIH6_HUMAN Inter-alpha-trypsin inhibitor heavy chain H6 OS=Homo sapiens OX=9606 GN=ITIH6 PE=1 SV=1
14	Q61702	2.56e-06	54.3	907	0.024	0.032	ITIH1_MOUSE Inter-alpha-trypsin inhibitor heavy chain H1 OS=Mus musculus OX=10090 GN=Itih1 PE=1 SV=2
15	Q61704	6.08e-05	49.7	889	0.036	0.048	ITIH3_MOUSE Inter-alpha-trypsin inhibitor heavy chain H3 OS=Mus musculus OX=10090 GN=Itih3 PE=1 SV=3
16	Q63416	4.94e-04	47.0	887	0.020	0.027	ITIH3_RAT Inter-alpha-trypsin inhibitor heavy chain H3 OS=Rattus norvegicus OX=10116 GN=Itih3 PE=2 SV=1
17	P19827	0.001	45.8	911	0.034	0.044	ITIH1_HUMAN Inter-alpha-trypsin inhibitor heavy chain H1 OS=Homo sapiens OX=9606 GN=ITIH1 PE=1 SV=3
18	O00534	0.003	44.3	786	0.037	0.056	VMA5A_HUMAN von Willebrand factor A domain-containing protein 5A OS=Homo sapiens OX=9606 GN=VWA5A PE=1 SV=2
19	Q06033	0.004	43.9	890	0.019	0.026	ITIH3_HUMAN Inter-alpha-trypsin inhibitor heavy chain H3 OS=Homo sapiens OX=9606 GN=ITIH3 PE=1 SV=2
20	A8K7I4	0.005	43.5	914	0.040	0.051	CLCA1_HUMAN Calcium-activated chloride channel regulator 1 OS=Homo sapiens OX=9606 GN=CLCA1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11271 PorA	6.1e+02	11.1	Porin PorA
2	PF00092 VWA	1.4e-07	43.4	von Willebrand factor type A domain
3	PF13519 VWA_2	3.8e-11	55.0	von Willebrand factor type A domain
4	PF13768 VWA_3	2e-67	237.5	von Willebrand factor type A domain
5	PF05762 VWA_CoxE	8.4	17.3	VWA domain containing CoxE-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374049

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266735	0.773	Small nuclear ribonucleoprotein F
2	9606.ENSP00000374323	0.738	Ephrin type-A receptor 6
3	9606.ENSP00000483312	0.692	WD repeat-containing protein 38
4	9606.ENSP00000334415	0.669	Protein FAM183A
5	9606.ENSP00000342931	0.658	Pituitary-specific positive transcription factor 1
6	9606.ENSP00000373169	0.622	D(3) dopamine receptor
7	9606.ENSP00000435550	0.610	Zinc finger C2HC-type containing 1C
8	9606.ENSP00000323612	0.602	Olfactory receptor 5T1
9	9606.ENSP00000297913	0.600	Olfactory receptor 1Q1
10	9606.ENSP00000297591	0.581	Protein virilizer homolog
11	9606.ENSP00000366380	0.556	Olfactory receptor 2W1
12	9606.ENSP00000452773	0.556	Coiled-coil domain-containing protein 32
13	9606.ENSP00000428878	0.519	Zinc finger protein 721
14	9606.ENSP00000264819	0.518	Mesoderm induction early response protein 2
15	9606.ENSP00000262726	0.516	EF-hand calcium-binding domain-containing protein 6
16	9606.ENSP00000363753	0.505	Protein Simiate

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.978	cellular process
GO:0065007	0.910	biological regulation
GO:0050789	0.554	regulation of biological process
GO:0050794	0.529	regulation of cellular process
GO:0071704	0.446	organic substance metabolic process
GO:0050896	0.437	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.996	nucleoplasm
GO:0005829	0.976	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]