StarFunc result for job id A6NCL1

User Input

>input (334 residues)
MNTILPCQDQYFVGGQSYNCPYSTTTSESSVDVSTETWVSFWAAGLLDNRELQQAPQAQE
SFSDSNFPLPDLCSWEEAQLSSQLYRNKQLQDTLVQKEEELARLHEENNHLRQYLNSALV
KCLEEKAKKLLSSDEFSKAYGKFRKGKRKSKEQRYSPAEIPHPKNAKRNLSSEFANCEEQ
AGPPVDPWVLQTLGLKDLDTIDDTSSANYSALASHPRRVASTFSQFPDDAVDYKNIPRED
MPIDYRGDRTTPLHSTATHGEDFHILSQLSNPPVGLKTLPYYTAHVSPNKTEMAFSTSLS
PHCNVKTHSFHQGQAFVRRDEEGGWKFTWVPKQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NCL1	1.000	1.000	2.118E-48	334	1.000	1.000	A6NCL1.pdb.gz	GEMC1_HUMAN Geminin coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GMNC PE=1 SV=2
2	AFDB:Q3URY2	0.406	0.407	3.769E-33	333	0.787	0.790	Q3URY2.pdb.gz	GEMC1_MOUSE Geminin coiled-coil domain-containing protein 1 OS=Mus musculus OX=10090 GN=Gmnc PE=2 SV=1
3	AFDB:D3YN49	0.281	0.293	1.224E-20	316	0.491	0.519	D3YN49.pdb.gz	GEMC1_XENLA Geminin coiled-coil domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=gmnc PE=1 SV=1
4	AFDB:E7FDS4	0.220	0.197	1.645E-15	382	0.452	0.395	E7FDS4.pdb.gz	E7FDS4_DANRE Geminin coiled-coil domain-containing OS=Danio rerio OX=7955 GN=gmnc PE=4 SV=1
5	AFDB:P46668	0.159	0.170	1.194E-2	311	0.144	0.154	P46668.pdb.gz	ATHB6_ARATH Homeobox-leucine zipper protein ATHB-6 OS=Arabidopsis thaliana OX=3702 GN=ATHB-6 PE=1 SV=1
6	AFDB:Q54CD2	0.122	0.070	1.437E-2	716	0.147	0.068	Q54CD2.pdb.gz	Q54CD2_DICDI Kelch repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293044 PE=4 SV=1
7	AFDB:P40473	0.127	0.120	1.730E-2	351	0.156	0.148	P40473.pdb.gz	POG1_YEAST Transcriptional activator POG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=POG1 PE=1 SV=1
8	AFDB:Q1ZXN8	0.084	0.070	2.082E-2	411	0.132	0.107	Q1ZXN8.pdb.gz	Q1ZXN8_DICDI DUF1325 family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0272054 PE=4 SV=1
9	AFDB:Q8GXY0	0.072	0.056	2.356E-2	467	0.102	0.073	Q8GXY0.pdb.gz	Q8GXY0_ARATH At2g37930 OS=Arabidopsis thaliana OX=3702 GN=At2g37930 PE=2 SV=1
10	AFDB:Q8T3S1	0.103	0.054	2.506E-2	749	0.135	0.060	Q8T3S1.pdb.gz	Q8T3S1_DROME AT02150p OS=Drosophila melanogaster OX=7227 GN=Srpk79D PE=2 SV=1
11	PDB:2oy5O	0.098	0.129	6.765E-1	250	0.006	0.008	2oy5O.pdb.gz
12	PDB:6ybt1	0.103	0.062	7.197E-1	588	0.018	0.010	6ybt1.pdb.gz
13	PDB:3cfoA	0.072	0.028	7.656E-1	906	0.009	0.003	3cfoA.pdb.gz	Structure of the replication complex of a POL Alpha family DNA Polymerase
14	PDB:3c96A	0.081	0.071	8.663E-1	381	0.012	0.010	3c96A.pdb.gz	Crystal structure of the flavin-containing monooxygenase phzS from Pseudomonas aeruginosa.
15	PDB:3s5wB	0.073	0.059	8.663E-1	414	0.015	0.012	3s5wB.pdb.gz	Two Structures of an N-Hydroxylating Flavoprotein Monooxygenase: ORNITHINE HYDROXYLASE FROM PSEUDOMONAS AERUGINOSA.
16	PDB:4iluA	0.060	0.098	9.803E-1	165	0.024	0.048	4iluA.pdb.gz
17	PDB:3gyxB	0.100	0.193	1.043	166	0.009	0.018	3gyxB.pdb.gz	Crystal structure of Adenylylsulfate reductase from Desulfovibrio gigas suggests a potential self-regulation mechanism involving the C terminus of the beta-subunit
18	PDB:4g6hA	0.081	0.058	1.043	472	0.009	0.006	4g6hA.pdb.gz	Structural insight into the type-II mitochondrial NADH dehydrogenases.
19	PDB:3cirA	0.056	0.035	1.109	541	0.009	0.006	3cirA.pdb.gz	A threonine on the active site loop controls transition state formation in Escherichia coli respiratory complex II.
20	PDB:6s9vB	0.073	0.051	1.109	492	0.015	0.010	6s9vB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NCL1	0.0	699	334	1.000	1.000	GEMC1_HUMAN Geminin coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GMNC PE=1 SV=2
2	Q3URY2	0.0	531	333	0.787	0.790	GEMC1_MOUSE Geminin coiled-coil domain-containing protein 1 OS=Mus musculus OX=10090 GN=Gmnc PE=2 SV=1
3	D3YN49	4.67e-98	294	316	0.512	0.541	GEMC1_XENLA Geminin coiled-coil domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=gmnc PE=1 SV=1
4	E7FDS4	4.16e-65	212	382	0.464	0.406	E7FDS4_DANRE Geminin coiled-coil domain-containing OS=Danio rerio OX=7955 GN=gmnc PE=4 SV=1
5	Q08B36	7.39e-05	46.6	374	0.054	0.048	MCIN_XENLA Multicilin OS=Xenopus laevis OX=8355 GN=mcidas PE=1 SV=2
6	D6RGH6	1.51e-04	45.4	385	0.054	0.047	MCIN_HUMAN Multicilin OS=Homo sapiens OX=9606 GN=MCIDAS PE=1 SV=1
7	Q3UZ45	1.85e-04	45.1	379	0.054	0.047	MCIN_MOUSE Multicilin OS=Mus musculus OX=10090 GN=Mcidas PE=1 SV=1
8	P0A1J9	1.9	32.7	331	0.063	0.063	FLIG_SALTY Flagellar motor switch protein FliG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=fliG PE=1 SV=1
9	P0ABZ1	2.1	32.3	331	0.063	0.063	FLIG_ECOLI Flagellar motor switch protein FliG OS=Escherichia coli (strain K12) OX=83333 GN=fliG PE=1 SV=1
10	Q92M29	2.3	31.2	120	0.048	0.133	Q92M29_RHIME Single domain response regulator OS=Rhizobium meliloti (strain 1021) OX=266834 GN=SMc04044 PE=4 SV=1
11	Q57WE8	2.8	32.7	4334	0.102	0.008	Q57WE8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.760 PE=4 SV=1
12	P11205	3.5	32.3	2204	0.075	0.011	L_NDVB RNA-directed RNA polymerase L OS=Newcastle disease virus (strain Beaudette C/45) OX=11178 GN=L PE=3 SV=1
13	P29352	4.2	32.0	802	0.054	0.022	PTN22_MOUSE Tyrosine-protein phosphatase non-receptor type 22 OS=Mus musculus OX=10090 GN=Ptpn22 PE=1 SV=1
14	P42774	4.6	31.2	315	0.084	0.089	GBF1_ARATH G-box-binding factor 1 OS=Arabidopsis thaliana OX=3702 GN=GBF1 PE=1 SV=2
15	Q07890	5.3	31.6	1332	0.102	0.026	SOS2_HUMAN Son of sevenless homolog 2 OS=Homo sapiens OX=9606 GN=SOS2 PE=1 SV=2
16	Q9U389	5.8	31.2	402	0.042	0.035	ALLO1_CAEEL Allophagy receptor allo-1 OS=Caenorhabditis elegans OX=6239 GN=allo-1 PE=1 SV=2
17	Q9HUN4	9.1	30.4	358	0.063	0.059	ALR1_PSEAE Alanine racemase, biosynthetic OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=alr PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07743 HSCB_C	5.9e+02	12.3	HSCB C-terminal oligomerisation domain
2	PF09457 RBD-FIP	3.7	18.9	FIP domain
3	PF06156 YabA	90	15.1	Initiation control protein YabA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000406164

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000426359	0.845	Multicilin
2	9606.ENSP00000368686	0.815	Transcription factor E2F4
3	9606.ENSP00000268138	0.814	Treslin
4	9606.ENSP00000366672	0.789	D-aminoacyl-tRNA deacylase 1
5	9606.ENSP00000260810	0.772	DNA topoisomerase 2-binding protein 1
6	9606.ENSP00000230056	0.770	Geminin
7	9606.ENSP00000323880	0.736	Forkhead box protein J1
8	9606.ENSP00000282572	0.687	Cyclin-O
9	9606.ENSP00000342356	0.675	Osteocrin
10	9606.ENSP00000370781	0.646	Cell division cycle protein 20 homolog B
11	9606.ENSP00000481046	0.645	Pyridoxal phosphate phosphatase PHOSPHO2
12	9606.ENSP00000298050	0.633	Deuterosome assembly protein 1
13	9606.ENSP00000299213	0.622	La-related protein 6
14	9606.ENSP00000405726	0.601	Cell division control protein 45 homolog
15	9606.ENSP00000482313	0.571	ATP-dependent DNA helicase Q4
16	9606.ENSP00000353098	0.566	Mini-chromosome maintenance complex-binding protein
17	9606.ENSP00000306335	0.552	DNA-binding protein RFX2
18	9606.ENSP00000358512	0.549	Protein mab-21-like 3
19	9606.ENSP00000293889	0.529	Coiled-coil domain-containing protein 78
20	9606.ENSP00000398124	0.502	Transcription factor E2F5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0046483	0.988	heterocycle metabolic process
GO:1901360	0.986	organic cyclic compound metabolic process
GO:0006725	0.986	cellular aromatic compound metabolic process
GO:0090304	0.976	nucleic acid metabolic process
GO:0016043	0.913	cellular component organization
GO:0006259	0.911	DNA metabolic process
GO:0006996	0.867	organelle organization
GO:0006260	0.846	DNA replication
GO:0065007	0.786	biological regulation
GO:0050789	0.744	regulation of biological process
GO:0050794	0.660	regulation of cellular process
GO:0044085	0.583	cellular component biogenesis
GO:0022607	0.562	cellular component assembly
GO:0019222	0.496	regulation of metabolic process
GO:0060255	0.477	regulation of macromolecule metabolic process
GO:0070925	0.421	organelle assembly
GO:0080090	0.387	regulation of primary metabolic process
GO:0051171	0.387	regulation of nitrogen compound metabolic process
GO:0031323	0.387	regulation of cellular metabolic process
GO:0019219	0.357	regulation of nucleobase-containing compound metabolic process
GO:0120031	0.348	plasma membrane bounded cell projection assembly
GO:0044782	0.344	cilium organization
GO:0060271	0.312	cilium assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043232	0.949	intracellular non-membrane-bounded organelle
GO:0005737	0.617	cytoplasm
GO:0032991	0.450	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]