StarFunc result for job id A6NCN2

User Input

>input (255 residues)
MEANSGRLASELNHVQEVLEGYKKKYEEEVALRATAENEFVALKKDVDCAYLRKSDLEAN
VEALTQEIDFLRRLYEEEIRVLQSHISDTSVVVKMDNSRDLNMHCVITEIKAQYDDIATR
SRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEA
AVAQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLAWTLRSPPTGA
CWRARSRGCVRALVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NCN2	1.000	1.000	5.364E-36	255	1.000	1.000	A6NCN2.pdb.gz	KR87P_HUMAN Putative keratin-87 protein OS=Homo sapiens OX=9606 GN=KRT87P PE=5 SV=4
2	AFDB:Q14533	0.611	0.347	2.040E-26	505	0.855	0.432	Q14533.pdb.gz	KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens OX=9606 GN=KRT81 PE=1 SV=3
3	AFDB:Q9NSB2	0.509	0.224	6.087E-19	600	0.600	0.255	Q9NSB2.pdb.gz	KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens OX=9606 GN=KRT84 PE=2 SV=2
4	AFDB:Q8BGZ7	0.587	0.318	1.366E-16	551	0.533	0.247	Q8BGZ7.pdb.gz	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
5	AFDB:A0A1D5PXP0	0.563	0.294	4.592E-16	522	0.522	0.255	A0A1D5PXP0.pdb.gz
6	AFDB:Q01546	0.499	0.211	8.084E-16	638	0.498	0.199	Q01546.pdb.gz	K22O_HUMAN Keratin, type II cytoskeletal 2 oral OS=Homo sapiens OX=9606 GN=KRT76 PE=1 SV=2
7	AFDB:P13647	0.564	0.289	1.211E-15	590	0.529	0.229	P13647.pdb.gz	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
8	AFDB:P08729	0.735	0.430	1.814E-15	469	0.514	0.279	P08729.pdb.gz	K2C7_HUMAN Keratin, type II cytoskeletal 7 OS=Homo sapiens OX=9606 GN=KRT7 PE=1 SV=5
9	AFDB:Q29426	0.501	0.223	3.462E-15	629	0.510	0.207	Q29426.pdb.gz	K2C3_RABIT Keratin, type II cytoskeletal 3 OS=Oryctolagus cuniculus OX=9986 GN=KRT3 PE=2 SV=1
10	AFDB:Q9Z331	0.696	0.348	3.462E-15	562	0.522	0.237	Q9Z331.pdb.gz	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
11	PDB:5n9jG	0.159	0.243	9.591	163	0.035	0.055	5n9jG.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NCN2	0.0	518	255	1.000	1.000	KR87P_HUMAN Putative keratin-87 protein OS=Homo sapiens OX=9606 GN=KRT87P PE=5 SV=4
2	P78385	1.51e-156	446	493	0.863	0.446	KRT83_HUMAN Keratin, type II cuticular Hb3 OS=Homo sapiens OX=9606 GN=KRT83 PE=1 SV=2
3	O43790	5.22e-156	444	486	0.863	0.453	KRT86_HUMAN Keratin, type II cuticular Hb6 OS=Homo sapiens OX=9606 GN=KRT86 PE=1 SV=1
4	Q14533	1.45e-154	441	505	0.855	0.432	KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens OX=9606 GN=KRT81 PE=1 SV=3
5	P78386	2.34e-148	426	507	0.816	0.410	KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens OX=9606 GN=KRT85 PE=1 SV=1
6	A0A8I5ZLV7	3.15e-146	419	487	0.792	0.415	A0A8I5ZLV7_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
7	A7M776	5.49e-146	419	479	0.792	0.422	A7M776_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=2 SV=1
8	A0A8I6G2U8	8.99e-146	417	447	0.792	0.452	A0A8I6G2U8_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
9	A0A8I6AFC7	2.98e-145	417	488	0.792	0.414	A0A8I6AFC7_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
10	Q6IG08	4.88e-144	416	555	0.792	0.364	Q6IG08_RAT Type II keratin Kb23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=2 SV=1
11	A0A0G2KA07	7.02e-144	416	543	0.792	0.372	A0A0G2KA07_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
12	Q99M73	2.35e-104	316	603	0.600	0.254	KRT84_MOUSE Keratin, type II cuticular Hb4 OS=Mus musculus OX=10090 GN=Krt84 PE=2 SV=2
13	Q9NSB2	1.59e-102	311	600	0.600	0.255	KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens OX=9606 GN=KRT84 PE=2 SV=2
14	Q9NSB4	3.26e-99	300	513	0.592	0.294	KRT82_HUMAN Keratin, type II cuticular Hb2 OS=Homo sapiens OX=9606 GN=KRT82 PE=1 SV=3
15	Q6P6Q2	3.02e-91	282	576	0.529	0.234	K2C5_RAT Keratin, type II cytoskeletal 5 OS=Rattus norvegicus OX=10116 GN=Krt5 PE=1 SV=1
16	Q922U2	8.50e-91	281	580	0.529	0.233	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
17	P13647	1.88e-90	280	590	0.529	0.229	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
18	Q8BGZ7	4.63e-90	278	551	0.533	0.247	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
19	P50446	9.09e-90	277	553	0.533	0.246	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
20	O95678	1.76e-88	274	551	0.518	0.240	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13166 AAA_13	4.8e+02	10.8	AAA domain
2	PF15915 BAT	7.6	17.9	GAF and HTH_10 associated domain
3	PF07888 CALCOCO1	4	17.9	Calcium binding and coiled-coil domain (CALCOCO1) like
4	PF20270 CATRA-C	4.1e+02	13.0	CASPASE and TPR Repeat-Associated C-terminal domain
5	PF05667 CCDC22	2.4e+02	11.9	Coiled-coil domain-containing protein 22
6	PF10473 CENP-F_leu_zip	8.7e+02	11.3	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
7	PF04977 DivIC	2.5e+02	12.8	Septum formation initiator
8	PF06698 DUF1192	57	15.2	Protein of unknown function (DUF1192)
9	PF03564 DUF1759	8.4e+02	11.3	Protein of unknown function (DUF1759)
10	PF14362 DUF4407	2.2e+02	12.5	Domain of unknown function (DUF4407)
11	PF16271 DUF4924	7.1	18.1	Domain of unknown function (DUF4924)
12	PF16378 DUF4988	6.5e+02	11.3	Domain of unknown function
13	PF19551 DUF6074	3.5e+02	12.9	Family of unknown function (DUF6074)
14	PF05960 DUF885	4.5	18.4	Bacterial protein of unknown function (DUF885)
15	PF08702 Fib_alpha	3.7e+02	12.7	Fibrinogen alpha/beta chain family
16	PF00038 Filament	9.1e-62	221.0	Intermediate filament protein
17	PF05377 FlaC_arch	8e+02	11.8	Flagella accessory protein C (FlaC)
18	PF13851 GAS	67	14.3	Growth-arrest specific micro-tubule binding
19	PF04399 Glutaredoxin2_C	1.2e+02	13.9	Glutaredoxin 2, C terminal domain
20	PF15619 Lebercilin	7.6e+02	11.1	Ciliary protein causing Leber congenital amaurosis disease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000008485

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000018841	0.557	Zinc finger protein 546
2	9598.ENSPTRP00000039913	0.551	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.905	structural molecule activity
GO:0005200	0.814	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.937	cellular process
GO:0045103	0.849	intermediate filament-based process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.998	cellular anatomical entity
GO:0005576	0.928	extracellular region
GO:0005622	0.869	intracellular anatomical structure
GO:0005615	0.834	extracellular space
GO:0043228	0.775	non-membrane-bounded organelle
GO:0043232	0.767	intracellular non-membrane-bounded organelle
GO:0005856	0.487	cytoskeleton
GO:0043227	0.337	membrane-bounded organelle
GO:0099512	0.329	supramolecular fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]