StarFunc result for job id A6NCQ9

[Download result.tar.bz2 for all prediction results]

User Input

>input (220 residues)
MSEGESKDSSGSECPVCYEKFRDLEGASRTLSCGHVFCHDCLVKYLLSTRVDGQVQRTLV
CPICRYVTFLSKKSSRWPSMLDKSSQTLAVPVGLPSVPPLDSLGHTNPLAASSPAWRPPP
GQARPPGSPGQSAQLPLDLLPSLPRESQIFVISRHGMPLGEQDSVLPRRSLAELSEASLA
PRSARAFCCRSRALLLITLIAVVAVVAAILPWVLLVRKQA

Download query sequence and structure.

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O64824	0.201	0.195	3.361E-3	227	0.186	0.181	O64824.pdb.gz	O64824_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=At2g23780 PE=1 SV=1
2	AFDB:Q9Y7K6	0.203	0.065	1.020E-1	741	0.150	0.045	Q9Y7K6.pdb.gz	YGI4_SCHPO Uncharacterized RING finger protein C2A9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2A9.04c PE=4 SV=1
3	AFDB:Q96A61	0.164	0.122	1.512E-1	297	0.123	0.091	Q96A61.pdb.gz	TRI52_HUMAN E3 ubiquitin-protein ligase TRIM52 OS=Homo sapiens OX=9606 GN=TRIM52 PE=1 SV=1
4	AFDB:Q9HEV3	0.147	0.115	1.724E-1	320	0.205	0.141	Q9HEV3.pdb.gz	Q9HEV3_EMEND GATA factor AREB beta OS=Emericella nidulans OX=162425 GN=areB PE=4 SV=1
5	PDB:5dkaA	0.176	0.388	1.964E-1	96	0.073	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
6	PDB:5a31B	0.172	0.422	2.391E-1	84	0.077	0.202	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
7	PDB:5l9uB	0.169	0.483	2.912E-1	71	0.068	0.211	5l9uB.pdb.gz
8	PDB:7b5lH	0.193	0.104	3.109E-1	423	0.068	0.035	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
9	PDB:5gm6a	0.166	0.287	5.994E-1	123	0.059	0.106	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
10	AFDB:Q9LX93	0.203	0.153	7.305E-1	301	0.168	0.123	Q9LX93.pdb.gz	ATL55_ARATH E3 ubiquitin-protein ligase RING1 OS=Arabidopsis thaliana OX=3702 GN=ATL55 PE=1 SV=1
11	AFDB:Q68DV7	0.180	0.056	8.330E-1	783	0.223	0.063	Q68DV7.pdb.gz	RNF43_HUMAN E3 ubiquitin-protein ligase RNF43 OS=Homo sapiens OX=9606 GN=RNF43 PE=1 SV=1
12	AFDB:Q9M371	0.137	0.048	9.498E-1	790	0.159	0.044	Q9M371.pdb.gz	Q9M371_ARATH Extra-large G-like protein, putative (DUF3133) OS=Arabidopsis thaliana OX=3702 GN=F15G16.60 PE=1 SV=1
13	AFDB:M9PE32	0.148	0.029	1.014	1314	0.168	0.028	M9PE32.pdb.gz	M9PE32_DROME Fife, isoform D OS=Drosophila melanogaster OX=7227 GN=Fife PE=1 SV=1
14	AFDB:Q5A432	0.147	0.053	1.083	688	0.118	0.038	Q5A432.pdb.gz	GAT1_CANAL Transcriptional regulatory protein GAT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GAT1 PE=2 SV=1
15	AFDB:Q5CCK4	0.162	0.066	1.083	780	0.155	0.044	Q5CCK4.pdb.gz	VAL2_ARATH B3 domain-containing transcription repressor VAL2 OS=Arabidopsis thaliana OX=3702 GN=VAL2 PE=1 SV=1
16	PDB:7oikA	0.167	0.009	1.234	4426	0.064	0.003	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
17	PDB:2lgvA	0.162	0.332	1.502	100	0.086	0.190	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
18	PDB:7ns4b	0.137	0.090	1.604	340	0.041	0.026	7ns4b.pdb.gz	GID E3 ligase supramolecular chelate assembly configures multipronged ubiquitin targeting of an oligomeric metabolic enzyme.
19	PDB:6ft6u	0.141	0.195	1.713	150	0.041	0.060	6ft6u.pdb.gz	Structure of the nuclear exosome captured on a maturing preribosome.
20	PDB:8a3tU	0.167	0.307	1.953	114	0.059	0.114	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9FY48	8.08e-06	48.5	1625	0.109	0.015	KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana OX=3702 GN=KEG PE=1 SV=2
2	Q96D59	1.02e-05	47.0	192	0.114	0.130	RN183_HUMAN E3 ubiquitin-protein ligase RNF183 OS=Homo sapiens OX=9606 GN=RNF183 PE=1 SV=2
3	Q8QZS5	1.26e-05	46.6	190	0.118	0.137	RN183_MOUSE E3 ubiquitin-protein ligase RNF183 OS=Mus musculus OX=10090 GN=Rnf183 PE=1 SV=1
4	F4HY36	1.43e-05	47.8	1805	0.132	0.016	F4HY36_ARATH Protein translocase subunit SecA OS=Arabidopsis thaliana OX=3702 GN=SECA2 PE=1 SV=1
5	Q557I6	8.77e-05	45.1	552	0.109	0.043	Q557I6_DICDI RING-type E3 ubiquitin transferase OS=Dictyostelium discoideum OX=44689 GN=mip1-2 PE=4 SV=1
6	A0A384LEC9	1.24e-04	44.3	263	0.109	0.091	A0A384LEC9_ARATH RING-type domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At3g29270 PE=1 SV=1
7	Q84JZ7	1.24e-04	44.3	263	0.109	0.091	Q84JZ7_ARATH At3g29270 OS=Arabidopsis thaliana OX=3702 GN=At3g29270 PE=1 SV=1
8	A0A0R4IL45	1.27e-04	44.7	663	0.105	0.035	A0A0R4IL45_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim32 PE=3 SV=1
9	A8WGA9	1.37e-04	44.7	663	0.105	0.035	A8WGA9_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim32 PE=2 SV=1
10	Q498M5	1.40e-04	44.7	735	0.100	0.030	SH3R2_RAT E3 ubiquitin-protein ligase SH3RF2 OS=Rattus norvegicus OX=10116 GN=Sh3rf2 PE=1 SV=1
11	Q38BI4	2.40e-04	43.5	387	0.095	0.054	Q38BI4_TRYB2 RING-type E3 ubiquitin transferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.3100 PE=4 SV=1
12	Q9C040	2.62e-04	43.9	744	0.086	0.026	TRIM2_HUMAN Tripartite motif-containing protein 2 OS=Homo sapiens OX=9606 GN=TRIM2 PE=1 SV=1
13	Q9ESN6	2.80e-04	43.5	744	0.086	0.026	TRIM2_MOUSE Tripartite motif-containing protein 2 OS=Mus musculus OX=10090 GN=Trim2 PE=1 SV=1
14	D3ZQG6	3.01e-04	43.5	744	0.086	0.026	TRIM2_RAT Tripartite motif-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Trim2 PE=1 SV=2
15	Q13049	3.09e-04	43.5	653	0.095	0.032	TRI32_HUMAN E3 ubiquitin-protein ligase TRIM32 OS=Homo sapiens OX=9606 GN=TRIM32 PE=1 SV=2
16	Q8CH72	4.04e-04	43.1	655	0.095	0.032	TRI32_MOUSE E3 ubiquitin-protein ligase TRIM32 OS=Mus musculus OX=10090 GN=Trim32 PE=1 SV=2
17	Q9P1Y6	4.32e-04	43.1	1649	0.118	0.016	PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1 PE=1 SV=3
18	Q8N6D2	5.29e-04	42.4	247	0.100	0.089	RN182_HUMAN E3 ubiquitin-protein ligase RNF182 OS=Homo sapiens OX=9606 GN=RNF182 PE=1 SV=1
19	Q8TEC5	7.07e-04	42.4	729	0.095	0.029	SH3R2_HUMAN E3 ubiquitin-protein ligase SH3RF2 OS=Homo sapiens OX=9606 GN=SH3RF2 PE=1 SV=3
20	Q9N3T6	7.13e-04	42.4	468	0.123	0.058	Q9N3T6_CAEEL RING-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y47G6A.14 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09986 DUF2225	9.8e+02	10.8	Uncharacterized protein conserved in bacteria (DUF2225)
2	PF01363 FYVE	0.2	23.1	FYVE zinc finger
3	PF02318 FYVE_2	4.6	18.8	FYVE-type zinc finger
4	PF14447 Prok-RING_4	3.7	18.8	Prokaryotic RING finger family 4
5	PF10497 zf-4CXXC_R1	1.6	20.4	Zinc-finger domain of monoamine-oxidase A repressor R1
6	PF12861 zf-ANAPC11	8.4e+02	11.4	Anaphase-promoting complex subunit 11 RING-H2 finger
7	PF00097 zf-C3HC4	0.00011	33.3	Zinc finger, C3HC4 type (RING finger)
8	PF13923 zf-C3HC4_2	0.0069	27.5	Zinc finger, C3HC4 type (RING finger)
9	PF13920 zf-C3HC4_3	0.0089	27.2	Zinc finger, C3HC4 type (RING finger)
10	PF15227 zf-C3HC4_4	3.5	19.1	zinc finger of C3HC4-type, RING
11	PF02891 zf-MIZ	5.7e+02	11.7	MIZ/SP-RING zinc finger
12	PF11789 zf-Nse	5e+02	12.0	Zinc-finger of the MIZ type in Nse subunit
13	PF12678 zf-rbx1	78	15.0	RING-H2 zinc finger domain
14	PF17123 zf-RING_11	2.9	19.0	RING-like zinc finger
15	PF13639 zf-RING_2	2.1e-06	39.3	Ring finger domain
16	PF14570 zf-RING_4	44	15.2	RING/Ubox like zinc-binding domain
17	PF14634 zf-RING_5	2.2e-05	35.6	zinc-RING finger domain
18	PF13445 zf-RING_UBOX	1.5e-06	39.4	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Download graph for PPI

Top PPI partners to 9606.ENSP00000382330

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339830	0.662	Transmembrane protein 220
2	9606.ENSP00000431971	0.635	Atherin
3	9606.ENSP00000371051	0.618	Zinc finger ZZ-type and EF-hand domain containing 1
4	9606.ENSP00000215567	0.537	Very-long-chain enoyl-CoA reductase
5	9606.ENSP00000356917	0.518	Olfactomedin-like protein 2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

Download graph for Molecular Function (MF)

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061659	0.860	ubiquitin-like protein ligase activity
GO:0061630	0.834	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Download graph for Biological Process (BP)

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008152	0.992	metabolic process
GO:0009987	0.986	cellular process
GO:0050794	0.965	regulation of cellular process
GO:0071704	0.952	organic substance metabolic process
GO:0044238	0.946	primary metabolic process
GO:1901564	0.888	organonitrogen compound metabolic process
GO:0051716	0.822	cellular response to stimulus
GO:0044237	0.822	cellular metabolic process
GO:0043170	0.670	macromolecule metabolic process
GO:0019538	0.553	protein metabolic process
GO:0016567	0.499	protein ubiquitination
GO:0019222	0.444	regulation of metabolic process
GO:0007154	0.438	cell communication
GO:0009966	0.422	regulation of signal transduction
GO:0080090	0.400	regulation of primary metabolic process
GO:0031323	0.400	regulation of cellular metabolic process
GO:0048519	0.386	negative regulation of biological process
GO:0048523	0.383	negative regulation of cellular process
GO:0007165	0.346	signal transduction
GO:1902531	0.305	regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Download graph for Cellular Component (CC)

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0016020	0.994	membrane
GO:0012505	0.988	endomembrane system
GO:0031090	0.946	organelle membrane
GO:0005783	0.936	endoplasmic reticulum
GO:0005789	0.722	endoplasmic reticulum membrane
GO:0005634	0.421	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Download sequence-, structure-, PPI-, deep learning-, Pfam family-based function prediction and the final consensus prediction

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[Download result.tar.bz2 for all prediction results]

[back to server]