StarFunc result for job id A6ND36

User Input

>input (823 residues)
MAFSQVQCLDDNHVNWRSSESKPEFFYSEEQRLALEALVARGRDAFYEVLKRENIRDFLS
ELELKRILETIEVYDPGSEDPRGTGPSQGPEDNGVGDGEEASGADGVPIEAEPLPSLEYW
PQKSDRSIPQLDLGWPDTIAYRGVTRASVYMQPPIDGQAHIKEVVRKMISQAQKVIAVVM
DMFTDVDIFKDLLDAGFKRKVAVYIIVDESNVKYFLHMCERACMHLGHLKNLRVRSSGGT
EFFTRSATKFKGALAQKFMFVDGDRAVCGSYSFTWSAARTDRNVISVLSGQVVEMFDRQF
QELYLMSHSVSLKGIPMEKEPEPEPIVLPSVVPLVPAGTVAKKLVNPKYALVKAKSVDEI
AKISSEKQEAKKPLGLKGPALAEHPGELPELLPPIHPGLLHLERANMFEYLPTWVEPDPE
PGSDILGYINIIDPNIWNPQPSQMNRIKIRDTSQASAQHQLWKQSQDSRPRPEPCPPPEP
SAPQDGVPAENGLPQGDPEPLPPVPKPRTVPVADVLARDSSDIGWVLELPKEEAPQNGTD
HRLPRMAGPGHAPLQRQLSVTQDDPESLGVGLPNGLDGVEEEDDDDYVTLSDQDSHSGSS
GRGPGPRRPSVASSVSEEYFEVREHSVPLRRRHSEQVANGPTPPPRRQLSAPHITRGTFV
GPQGGSPWAQSRGREEADALKRMQAQRSTDKEAQGQQFHHHRVPASGTRDKDGFPGPPRY
RSAADSVQSSTRNAGPAMAGPHHWQAKGGQVPRLLPDPGSPRLAQNARPMTDGRATEEHP
SPFGIPYSKLSQSKHLKARTGGSQWASSDSKRRAQAPRDRKDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6ND36	1.000	1.000	0.000	823	1.000	1.000	A6ND36.pdb.gz	FA83G_HUMAN Protein FAM83G OS=Homo sapiens OX=9606 GN=FAM83G PE=1 SV=2
2	AFDB:Q6ZRV2	0.227	0.160	4.400E-30	1179	0.247	0.172	Q6ZRV2.pdb.gz	FA83H_HUMAN Protein FAM83H OS=Homo sapiens OX=9606 GN=FAM83H PE=1 SV=3
3	AFDB:Q5T0W9	0.227	0.187	6.325E-30	1011	0.238	0.194	Q5T0W9.pdb.gz	FA83B_HUMAN Protein FAM83B OS=Homo sapiens OX=9606 GN=FAM83B PE=1 SV=1
4	AFDB:A0A087WXK8	0.231	0.304	3.023E-27	615	0.191	0.255	A0A087WXK8.pdb.gz	A0A087WXK8_HUMAN Chromosome 20 open reading frame 129 OS=Homo sapiens OX=9606 GN=FAM83D PE=1 SV=1
5	AFDB:Q86UY5	0.227	0.415	7.956E-27	434	0.154	0.293	Q86UY5.pdb.gz	FA83A_HUMAN Protein FAM83A OS=Homo sapiens OX=9606 GN=FAM83A PE=1 SV=1
6	PDB:6kz8A	0.147	0.154	4.008E-7	784	0.039	0.041	6kz8A.pdb.gz	Crystal structure of plant PLD alpha 1 reveals catalytic and regulatory mechanisms of eukaryotic phospholipase D.
7	PDB:7wdkA	0.138	0.131	9.888E-6	867	0.022	0.021	7wdkA.pdb.gz
8	PDB:7v55A	0.157	0.165	2.450E-5	781	0.028	0.029	7v55A.pdb.gz	Structural insights into PA3488-mediated inactivation of Pseudomonas aeruginosa PldA.
9	PDB:7v53A	0.135	0.121	5.378E-5	930	0.023	0.020	7v53A.pdb.gz
10	PDB:1xdpA	0.145	0.172	9.847E-5	687	0.032	0.038	1xdpA.pdb.gz	Crystal structure of a polyphosphate kinase and its implications for polyphosphate synthesis
11	PDB:1q32B	0.111	0.202	1.046E-4	420	0.022	0.043	1q32B.pdb.gz
12	AFDB:Q1ZS71	0.056	0.048	3.085E-3	1094	0.124	0.093	Q1ZS71.pdb.gz	Q1ZS71_PHOAS Ribonuclease E OS=Photobacterium angustum (strain S14 / CCUG 15956) OX=314292 GN=rne PE=1 SV=1
13	PDB:2ymbD	0.122	0.359	3.287E-3	231	0.019	0.069	2ymbD.pdb.gz	Escrt-III Binding Protein Mitd1 is Involved in Cytokinesis and Has an Unanticipated Pld Fold that Binds Membranes.
14	AFDB:Q6FPN0	0.053	0.051	6.773E-3	870	0.113	0.107	Q6FPN0.pdb.gz	AWP1_CANGA Adhesin AWP1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AWP1 PE=1 SV=1
15	AFDB:Q9ULK2	0.042	0.041	2.012E-2	861	0.101	0.096	Q9ULK2.pdb.gz	AT7L1_HUMAN Ataxin-7-like protein 1 OS=Homo sapiens OX=9606 GN=ATXN7L1 PE=1 SV=3
16	AFDB:F4J7T2	0.039	0.023	4.985E-2	1907	0.166	0.072	F4J7T2.pdb.gz	EAF1B_ARATH Chromatin modification-related protein EAF1 B OS=Arabidopsis thaliana OX=3702 GN=EAF1B PE=1 SV=1
17	AFDB:Q9GPJ1	0.059	0.040	5.626E-2	1503	0.134	0.073	Q9GPJ1.pdb.gz	SKEL2_DROME Protein Skeletor, isoforms D/E OS=Drosophila melanogaster OX=7227 GN=Skel PE=1 SV=3
18	PDB:1yaaA	0.069	0.127	6.367E-2	412	0.013	0.027	1yaaA.pdb.gz	Crystal structure of Saccharomyces cerevisiae cytosolic aspartate aminotransferase.
19	PDB:1jv1A	0.070	0.105	6.764E-2	490	0.017	0.029	1jv1A.pdb.gz	Crystal structures of two human pyrophosphorylase isoforms in complexes with UDPGlc(Gal)NAc: role of the alternatively spliced insert in the enzyme oligomeric assembly and active site architecture.
20	PDB:3a27A	0.076	0.221	1.033E-1	219	0.027	0.100	3a27A.pdb.gz	Structural basis of AdoMet-dependent aminocarboxypropyl transfer reaction catalyzed by tRNA-wybutosine synthesizing enzyme, TYW2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6ND36	0.0	1680	823	1.000	1.000	FA83G_HUMAN Protein FAM83G OS=Homo sapiens OX=9606 GN=FAM83G PE=1 SV=2
2	Q8NEG4	4.55e-89	292	500	0.191	0.314	FA83F_HUMAN Protein FAM83F OS=Homo sapiens OX=9606 GN=FAM83F PE=1 SV=1
3	Q2M2I3	4.02e-56	202	478	0.141	0.243	FA83E_HUMAN Protein FAM83E OS=Homo sapiens OX=9606 GN=FAM83E PE=1 SV=2
4	Q5T0W9	1.20e-54	206	1011	0.132	0.108	FA83B_HUMAN Protein FAM83B OS=Homo sapiens OX=9606 GN=FAM83B PE=1 SV=1
5	Q6ZRV2	1.33e-48	189	1179	0.125	0.087	FA83H_HUMAN Protein FAM83H OS=Homo sapiens OX=9606 GN=FAM83H PE=1 SV=3
6	Q9H4H8	8.71e-48	181	585	0.132	0.186	FA83D_HUMAN Protein FAM83D OS=Homo sapiens OX=9606 GN=FAM83D PE=1 SV=3
7	A0A087WXK8	1.06e-47	181	615	0.132	0.177	A0A087WXK8_HUMAN Chromosome 20 open reading frame 129 OS=Homo sapiens OX=9606 GN=FAM83D PE=1 SV=1
8	Q9BQN1	7.86e-45	175	747	0.134	0.147	FA83C_HUMAN Protein FAM83C OS=Homo sapiens OX=9606 GN=FAM83C PE=1 SV=3
9	Q86UY5	1.44e-42	163	434	0.125	0.237	FA83A_HUMAN Protein FAM83A OS=Homo sapiens OX=9606 GN=FAM83A PE=1 SV=1
10	P29353	0.89	35.4	583	0.057	0.081	SHC1_HUMAN SHC-transforming protein 1 OS=Homo sapiens OX=9606 GN=SHC1 PE=1 SV=4
11	P97473	2.0	34.3	365	0.023	0.052	TRBP2_MOUSE RISC-loading complex subunit TARBP2 OS=Mus musculus OX=10090 GN=Tarbp2 PE=1 SV=2
12	Q9U1X7	2.9	33.5	258	0.019	0.062	Q9U1X7_CAEEL Phosducin thioredoxin-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mau-8 PE=1 SV=1
13	Q8X0Z0	6.3	32.7	570	0.029	0.042	CARB_GIBFU Phytoene desaturase OS=Gibberella fujikuroi OX=5127 GN=carB PE=1 SV=2
14	Q8MY02	6.4	32.7	636	0.033	0.042	Q8MY02_DROME FI14518p OS=Drosophila melanogaster OX=7227 GN=pxb PE=2 SV=1
15	Q6FK23	7.3	32.7	1499	0.026	0.014	CDR1_CANGA Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CDR1 PE=1 SV=1
16	Q15633	7.4	32.3	366	0.022	0.049	TRBP2_HUMAN RISC-loading complex subunit TARBP2 OS=Homo sapiens OX=9606 GN=TARBP2 PE=1 SV=3
17	Q05192	7.9	32.3	808	0.044	0.045	FTF1B_DROME Nuclear hormone receptor FTZ-F1 beta OS=Drosophila melanogaster OX=7227 GN=Hr39 PE=1 SV=3
18	O94539	8.3	31.6	209	0.019	0.077	PAM17_SCHPO Presequence translocated-associated motor subunit pam17, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pam17 PE=3 SV=2
19	A0A0A0MRW6	8.5	32.3	1008	0.038	0.031	A0A0A0MRW6_HUMAN Nucleolar protein 6 OS=Homo sapiens OX=9606 GN=NOL6 PE=1 SV=1
20	Q9H6R4	9.0	32.3	1146	0.038	0.027	NOL6_HUMAN Nucleolar protein 6 OS=Homo sapiens OX=9606 GN=NOL6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07894 FAM83	3.1e-115	396.0	FAM83 A-H
2	PF13091 PLDc_2	5.8e-06	37.7	PLD-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373647

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000421689	0.785	Casein kinase I isoform alpha
2	9606.ENSP00000240651	0.757	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1
3	9606.ENSP00000352264	0.715	CD2-associated protein
4	9606.ENSP00000379008	0.709	Sodium/glucose cotransporter 5
5	9606.ENSP00000469880	0.664	Inactive serine/threonine-protein kinase VRK3
6	9606.ENSP00000259750	0.638	Tau-tubulin kinase 1
7	9606.ENSP00000437409	0.608	GRB2-related adapter protein-like
8	9606.ENSP00000408002	0.566	Serine/threonine-protein kinase VRK2
9	9606.ENSP00000369126	0.538	Casein kinase I isoform alpha-like
10	9606.ENSP00000358001	0.522	Transforming acidic coiled-coil-containing protein 2
11	9606.ENSP00000346065	0.515	Tudor domain-containing protein 6
12	9606.ENSP00000400258	0.514	Disks large-associated protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.809	enzyme binding
GO:0019901	0.519	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.995	cellular process
GO:0050896	0.973	response to stimulus
GO:0051716	0.964	cellular response to stimulus
GO:0007165	0.952	signal transduction
GO:0071363	0.945	cellular response to growth factor stimulus
GO:0007166	0.939	cell surface receptor signaling pathway
GO:0007178	0.926	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071772	0.899	response to BMP
GO:0030509	0.894	BMP signaling pathway
GO:0048518	0.362	positive regulation of biological process
GO:0048522	0.334	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0043232	0.936	intracellular non-membrane-bounded organelle
GO:0016020	0.873	membrane
GO:0099080	0.613	supramolecular complex
GO:0005856	0.608	cytoskeleton
GO:0099512	0.464	supramolecular fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]