StarFunc result for job id A6NDB9

User Input

>input (673 residues)
MAESSLYRQRLEVIAEKRRLQEEIRAARREVEEEKLRVERLKRKSLRERWLMDGAAAVPE
PSEDPTSKDPQSPEGQAQARIRNLEDSLFTLQSQLQLLQSASTGAQHKPSGRPSWRRQGH
RPLSQSIVEAGSVGQTDLNKRASLPAGLVGTPPESPSEPREDVLGFLPGPRQVPGAAGDS
SEANGPCPSPIPTPEQGLSQRAVPSEGRVGEAKGGGVVSVVWEGLRATEDCATGATGPEL
EAKVEEVVLEAIGDRKGAGSLELPAWVKEDRGIVEVVWEGVGGSDAEAMGEIGRVPEVVQ
TSSPRLQERLEAAASIEGEDVPQGSPEGDGQGGSGGEEGSFIWVERVTLSEEWEELLVEG
LEGPEVAGRERGDESPLGAEGAKTGGGEETWEAEKRKAEESMGIGSEEKPGTGRDEAEMS
PVVERKGGEKKLELESRGSAEKLGTEREGGEEPLGIERKVEGHLRAEKEGDEEKRGAEEE
EVEEPLGVEKKGGEEEPEATKEPLEAERKGGEETLEAEKRGGEESLETEKTQGTEGDLNL
EQGSREGSESQAEEMNEAGPPLEANTETRPEKEGPQPQEKPVGALEEEGVKPQTAAEGQG
PLGDATPLLAETPAPEQPAECQPLLQGEGPSANPSAHPVPTYAPARQPEPSAPTEGEEAS
GPKQKTCQCCAVM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NDB9	1.000	1.000	3.803E-87	673	1.000	1.000	A6NDB9.pdb.gz	PALM3_HUMAN Paralemmin-3 OS=Homo sapiens OX=9606 GN=PALM3 PE=1 SV=2
2	AFDB:O35607	0.054	0.037	4.258E-3	1038	0.104	0.067	O35607.pdb.gz	BMPR2_MOUSE Bone morphogenetic protein receptor type-2 OS=Mus musculus OX=10090 GN=Bmpr2 PE=1 SV=1
3	AFDB:Q28820	0.059	0.057	2.007E-2	706	0.141	0.135	Q28820.pdb.gz	TRDN_RABIT Triadin OS=Oryctolagus cuniculus OX=9986 GN=TRDN PE=1 SV=3
4	AFDB:Q8STF6	0.065	0.052	2.737E-2	887	0.146	0.110	Q8STF6.pdb.gz	DYC1_CAEEL Dystrophin-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=dyc-1 PE=1 SV=1
5	AFDB:P82179	0.067	0.065	4.226E-2	701	0.149	0.143	P82179.pdb.gz	TRDN_CANLF Triadin OS=Canis lupus familiaris OX=9615 GN=TRDN PE=1 SV=2
6	AFDB:Q57VP9	0.056	0.019	4.784E-2	2653	0.146	0.037	Q57VP9.pdb.gz	Q57VP9_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O4.100 PE=4 SV=1
7	AFDB:Q3V3V9	0.053	0.031	5.416E-2	1296	0.152	0.079	Q3V3V9.pdb.gz	CARL2_MOUSE Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Mus musculus OX=10090 GN=Carmil2 PE=1 SV=2
8	AFDB:Q9QX75	0.054	0.053	6.941E-2	687	0.143	0.140	Q9QX75.pdb.gz	TRDN_RAT Triadin OS=Rattus norvegicus OX=10116 GN=Trdn PE=1 SV=1
9	AFDB:Q7TN08	0.062	0.056	7.385E-2	757	0.169	0.151	Q7TN08.pdb.gz	DACT2_MOUSE Dapper homolog 2 OS=Mus musculus OX=10090 GN=Dact2 PE=1 SV=2
10	AFDB:Q9VRY4	0.066	0.030	7.385E-2	1833	0.146	0.053	Q9VRY4.pdb.gz	Q9VRY4_DROME LD13895p OS=Drosophila melanogaster OX=7227 GN=velo PE=1 SV=3
11	PDB:7z37DP1	0.126	0.279	6.615E-1	273	0.025	0.062	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
12	PDB:7vvuV	0.085	0.295	7.489E-1	113	0.028	0.168	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
13	PDB:7ungC4	0.069	0.196	1.576	219	0.027	0.082	7ungC4.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
14	PDB:6tuyA	0.072	0.073	1.899	667	0.027	0.027	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
15	PDB:7ungD3	0.066	0.127	1.899	317	0.024	0.050	7ungD3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:3mxzA	0.083	0.342	2.020	107	0.022	0.140	3mxzA.pdb.gz
17	PDB:6ta5D	0.074	0.141	2.020	345	0.012	0.023	6ta5D.pdb.gz
18	PDB:6xt9I	0.101	0.090	2.020	767	0.019	0.017	6xt9I.pdb.gz
19	PDB:3lssB	0.093	0.133	2.287	468	0.024	0.034	3lssB.pdb.gz	X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
20	PDB:6tz402	0.087	0.237	2.287	176	0.015	0.057	6tz402.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NDB9	0.0	1278	673	1.000	1.000	PALM3_HUMAN Paralemmin-3 OS=Homo sapiens OX=9606 GN=PALM3 PE=1 SV=2
2	C9JA33	3.66e-10	64.7	377	0.056	0.101	C9JA33_HUMAN PALM2 and AKAP2 fusion OS=Homo sapiens OX=9606 GN=PALM2AKAP2 PE=1 SV=1
3	G3X9P1	4.09e-10	60.5	139	0.058	0.281	G3X9P1_MOUSE Paralemmin A kinase anchor protein OS=Mus musculus OX=10090 GN=Pakap PE=1 SV=1
4	B1ALY0	4.13e-10	64.7	433	0.056	0.088	B1ALY0_HUMAN PALM2 and AKAP2 fusion (Fragment) OS=Homo sapiens OX=9606 GN=PALM2AKAP2 PE=1 SV=1
5	Q9YGL6	1.27e-09	63.2	386	0.052	0.091	PALM_CHICK Paralemmin-1 OS=Gallus gallus OX=9031 GN=PALM PE=1 SV=1
6	Q3UZT2	1.45e-09	60.5	198	0.056	0.192	Q3UZT2_MOUSE Paralemmin-2 OS=Mus musculus OX=10090 GN=Pakap PE=2 SV=1
7	O75781	3.46e-09	61.6	387	0.052	0.090	PALM_HUMAN Paralemmin-1 OS=Homo sapiens OX=9606 GN=PALM PE=1 SV=2
8	Q920Q0	5.34e-09	60.8	383	0.051	0.089	PALM_RAT Paralemmin-1 OS=Rattus norvegicus OX=10116 GN=Palm PE=1 SV=1
9	Q9Z0P4	7.74e-09	60.5	383	0.051	0.089	PALM_MOUSE Paralemmin-1 OS=Mus musculus OX=10090 GN=Palm PE=1 SV=1
10	Q9NP74	6.31e-05	48.5	551	0.040	0.049	PALMD_HUMAN Palmdelphin OS=Homo sapiens OX=9606 GN=PALMD PE=1 SV=1
11	Q9JHU2	8.84e-05	48.1	551	0.042	0.051	PALMD_MOUSE Palmdelphin OS=Mus musculus OX=10090 GN=Palmd PE=1 SV=1
12	Q4KM62	9.23e-05	48.1	551	0.042	0.051	PALMD_RAT Palmdelphin OS=Rattus norvegicus OX=10116 GN=Palmd PE=1 SV=1
13	F7AA26	2.28e-04	47.0	1137	0.045	0.026	F7AA26_MOUSE Paralemmin A kinase anchor protein (Fragment) OS=Mus musculus OX=10090 GN=Pakap PE=1 SV=1
14	Q12019	0.001	44.7	4910	0.070	0.010	MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDN1 PE=1 SV=1
15	Q5SXY1	1.1	35.0	1067	0.040	0.025	CYTSB_MOUSE Cytospin-B OS=Mus musculus OX=10090 GN=Specc1 PE=1 SV=2
16	Q8IDX6	4.0	33.1	3130	0.052	0.011	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
17	Q02040	7.6	32.3	695	0.091	0.088	AK17A_HUMAN A-kinase anchor protein 17A OS=Homo sapiens OX=9606 GN=AKAP17A PE=1 SV=2
18	Q8N3K9	8.9	32.3	4069	0.030	0.005	CMYA5_HUMAN Cardiomyopathy-associated protein 5 OS=Homo sapiens OX=9606 GN=CMYA5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03285 Paralemmin	6.4e-10	50.6	Paralemmin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344996

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353516	0.761	Olfactory receptor 2W3
2	9606.ENSP00000414237	0.747	Integrator complex subunit 2
3	9606.ENSP00000331087	0.728	Protein TSSC4
4	9606.ENSP00000403104	0.701	Single Ig IL-1-related receptor
5	9606.ENSP00000314709	0.694	Zinc fingers and homeoboxes protein 2
6	9606.ENSP00000297405	0.693	CUB and sushi domain-containing protein 3
7	9606.ENSP00000278937	0.681	Myelin protein zero-like protein 2
8	9606.ENSP00000403397	0.617	Palmitoyltransferase ZDHHC17
9	9606.ENSP00000219905	0.602	MAX gene-associated protein
10	9606.ENSP00000449137	0.563	UPF0575 protein C19orf67
11	9606.ENSP00000417335	0.556	Roundabout homolog 2
12	9606.ENSP00000371085	0.551	Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2
13	9606.ENSP00000272367	0.535	C-type lectin domain family 4 member F
14	9606.ENSP00000381234	0.527	annotation not available
15	9606.ENSP00000381231	0.509	Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L- homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine. Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons.
16	9606.ENSP00000356104	0.502	N-fatty-acyl-amino acid synthase/hydrolase PM20D1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0009987	0.985	cellular process
GO:0050794	0.984	regulation of cellular process
GO:0050896	0.961	response to stimulus
GO:0048519	0.958	negative regulation of biological process
GO:0048583	0.923	regulation of response to stimulus
GO:0009966	0.894	regulation of signal transduction
GO:0060759	0.859	regulation of response to cytokine stimulus
GO:0048585	0.749	negative regulation of response to stimulus
GO:0048523	0.661	negative regulation of cellular process
GO:0001959	0.640	regulation of cytokine-mediated signaling pathway
GO:0060761	0.621	negative regulation of response to cytokine stimulus
GO:0007154	0.515	cell communication
GO:0044419	0.425	biological process involved in interspecies interaction between organisms
GO:0051716	0.403	cellular response to stimulus
GO:0023052	0.397	signaling
GO:0051707	0.382	response to other organism
GO:0042221	0.331	response to chemical
GO:0009968	0.322	negative regulation of signal transduction
GO:0007165	0.301	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.987	intracellular anatomical structure
GO:0043226	0.975	organelle
GO:0043229	0.916	intracellular organelle
GO:0043227	0.913	membrane-bounded organelle
GO:0031981	0.888	nuclear lumen
GO:0005654	0.881	nucleoplasm
GO:0005737	0.667	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]