StarFunc result for job id A6NDG6

User Input

>input (321 residues)
MAAAEAGGDDARCVRLSAERAQALLADVDTLLFDCDGVLWRGETAVPGAPEALRALRARG
KRLGFITNNSSKTRAAYAEKLRRLGFGGPAGPGASLEVFGTAYCTALYLRQRLAGAPAPK
AYVLGSPALAAELEAVGVASVGVGPEPLQGEGPGDWLHAPLEPDVRAVVVGFDPHFSYMK
LTKALRYLQQPGCLLVGTNMDNRLPLENGRFIAGTGCLVRAVEMAAQRQADIIGKPSRFI
FDCVSQEYGINPERTVMVGDRLDTDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSK
KKMVPDFYVDSIADLLPALQG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NDG6	1.000	1.000	5.340E-68	321	1.000	1.000	A6NDG6.pdb.gz	PGP_HUMAN Glycerol-3-phosphate phosphatase OS=Homo sapiens OX=9606 GN=PGP PE=1 SV=1
2	AFDB:Q8VD52	0.861	0.894	9.636E-36	309	0.439	0.456	Q8VD52.pdb.gz	PLPP_RAT Chronophin OS=Rattus norvegicus OX=10116 GN=Pdxp PE=1 SV=2
3	PDB:5gynA	0.849	0.921	1.880E-35	295	0.439	0.478	5gynA.pdb.gz	Crystal structure of human pyridoxal 5'-phosphate phosphatase (Chronophin) mutant - C221S
4	AFDB:Q8GWU0	0.843	0.896	2.188E-31	301	0.349	0.372	Q8GWU0.pdb.gz	PGP2_ARATH Phosphoglycolate phosphatase 2 OS=Arabidopsis thaliana OX=3702 GN=PGLP2 PE=1 SV=1
5	AFDB:Q59WC5	0.822	0.855	2.583E-28	308	0.312	0.325	Q59WC5.pdb.gz	Q59WC5_CANAL 4-nitrophenylphosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHO15 PE=4 SV=1
6	AFDB:P19881	0.836	0.859	6.532E-28	312	0.305	0.314	P19881.pdb.gz	PNPP_YEAST 4-nitrophenylphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHO13 PE=1 SV=2
7	AFDB:Q00472	0.845	0.908	7.335E-28	298	0.324	0.349	Q00472.pdb.gz	PNPP_SCHPO 4-nitrophenylphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pho2 PE=4 SV=2
8	AFDB:G8BCM7	0.837	0.868	1.166E-27	309	0.324	0.337	G8BCM7.pdb.gz	G8BCM7_CANPC 4-nitrophenylphosphatase OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=PHO15 PE=4 SV=1
9	AFDB:Q8IBV0	0.767	0.764	2.339E-27	322	0.296	0.295	Q8IBV0.pdb.gz	Q8IBV0_PLAF7 4-nitrophenylphosphatase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0715000 PE=4 SV=1
10	AFDB:Q9VYT0	0.818	0.850	7.156E-26	308	0.265	0.276	Q9VYT0.pdb.gz	Q9VYT0_DROME RE04130p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG15739 PE=1 SV=2
11	AFDB:O76864	0.835	0.765	6.479E-25	352	0.252	0.230	O76864.pdb.gz	O76864_DROME EG:100G10.4 protein OS=Drosophila melanogaster OX=7227 GN=EG:100G10.4 PE=4 SV=1
12	PDB:4i9gA	0.724	0.708	4.067E-20	329	0.243	0.237	4i9gA.pdb.gz	Discovery of a glycerol 3-phosphate phosphatase reveals glycerophospholipid polar head recycling in Mycobacterium tuberculosis.
13	PDB:2c4nA	0.697	0.883	7.695E-20	250	0.259	0.332	2c4nA.pdb.gz	Structure and Activity Analyses of Escherichia Coli K-12 Nagd Provide Insight Into the Evolution of Biochemical Function in the Haloalkanoic Acid Dehalogenase Superfamily
14	PDB:2x4dA	0.707	0.829	4.135E-19	270	0.218	0.259	2x4dA.pdb.gz	Crystal Structure of Human Phospholysine Phosphohistidine Inorganic Pyrophosphate Phosphatase Lhpp
15	PDB:3hltA	0.684	0.845	2.688E-17	256	0.212	0.266	3hltA.pdb.gz
16	PDB:3kc2B	0.666	0.670	2.278E-13	319	0.206	0.207	3kc2B.pdb.gz	Crystal structure of mitochondrial HAD-like phosphatase from Saccharomyces cerevisiae
17	PDB:2x4dB	0.577	0.844	1.947E-12	213	0.178	0.268	2x4dB.pdb.gz	Crystal Structure of Human Phospholysine Phosphohistidine Inorganic Pyrophosphate Phosphatase Lhpp
18	PDB:3rf6B	0.639	0.590	1.108E-11	352	0.202	0.185	3rf6B.pdb.gz	Crystal structure of glycerol-3 phosphate bound HAD-like phosphatase from Saccharomyces cerevisiae
19	PDB:2w4mA	0.250	0.315	1.734E-5	250	0.159	0.204	2w4mA.pdb.gz
20	PDB:1rkqA	0.325	0.372	2.357E-4	271	0.146	0.173	1rkqA.pdb.gz	Crystal Structure of NYSGRC target T1436: A Hypothetical protein yidA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NDG6	0.0	648	321	1.000	1.000	PGP_HUMAN Glycerol-3-phosphate phosphatase OS=Homo sapiens OX=9606 GN=PGP PE=1 SV=1
2	D3ZDK7	0.0	591	321	0.903	0.903	PGP_RAT Glycerol-3-phosphate phosphatase OS=Rattus norvegicus OX=10116 GN=Pgp PE=1 SV=1
3	Q8CHP8	0.0	592	321	0.907	0.907	PGP_MOUSE Glycerol-3-phosphate phosphatase OS=Mus musculus OX=10090 GN=Pgp PE=1 SV=1
4	Q96GD0	2.78e-81	250	296	0.455	0.493	PLPP_HUMAN Chronophin OS=Homo sapiens OX=9606 GN=PDXP PE=1 SV=2
5	Q8VD52	7.59e-81	249	309	0.452	0.469	PLPP_RAT Chronophin OS=Rattus norvegicus OX=10116 GN=Pdxp PE=1 SV=2
6	Q3ZBF9	9.27e-81	249	296	0.442	0.480	PLPP_BOVIN Chronophin OS=Bos taurus OX=9913 GN=PDXP PE=1 SV=1
7	P60487	1.29e-79	246	292	0.430	0.473	PLPP_MOUSE Chronophin OS=Mus musculus OX=10090 GN=Pdxp PE=1 SV=1
8	Q8GWU0	3.31e-65	209	301	0.371	0.395	PGP2_ARATH Phosphoglycolate phosphatase 2 OS=Arabidopsis thaliana OX=3702 GN=PGLP2 PE=1 SV=1
9	Q59WC5	4.14e-53	178	308	0.324	0.338	Q59WC5_CANAL 4-nitrophenylphosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHO15 PE=4 SV=1
10	Q00472	4.21e-53	178	298	0.318	0.342	PNPP_SCHPO 4-nitrophenylphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pho2 PE=4 SV=2
11	G8BCM7	5.55e-52	175	309	0.318	0.330	G8BCM7_CANPC 4-nitrophenylphosphatase OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=PHO15 PE=4 SV=1
12	Q8IBV0	6.43e-48	165	322	0.287	0.286	Q8IBV0_PLAF7 4-nitrophenylphosphatase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0715000 PE=4 SV=1
13	P19881	6.07e-45	157	312	0.296	0.304	PNPP_YEAST 4-nitrophenylphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHO13 PE=1 SV=2
14	Q9W4W5	4.78e-33	125	305	0.274	0.289	Q9W4W5_DROME RE47284p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2680 PE=1 SV=2
15	Q9VYT0	3.72e-32	123	308	0.271	0.282	Q9VYT0_DROME RE04130p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG15739 PE=1 SV=2
16	O76864	3.64e-30	119	352	0.274	0.250	O76864_DROME EG:100G10.4 protein OS=Drosophila melanogaster OX=7227 GN=EG:100G10.4 PE=4 SV=1
17	Q6ZT62	4.05e-26	110	677	0.165	0.078	BGIN_HUMAN Bargin OS=Homo sapiens OX=9606 GN=BARGIN PE=1 SV=2
18	P0AF24	1.97e-24	101	250	0.259	0.332	NAGD_ECOLI Ribonucleotide monophosphatase NagD OS=Escherichia coli (strain K12) OX=83333 GN=nagD PE=1 SV=1
19	A4QFW4	3.27e-18	85.1	275	0.234	0.273	HDPA_CORGB Dihydroxyacetone phosphatase OS=Corynebacterium glutamicum (strain R) OX=340322 GN=hdpA PE=1 SV=1
20	O33194	9.13e-17	82.0	353	0.268	0.244	G3PP_MYCTU D-glycerol 3-phosphate phosphatase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1692 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13419 HAD_2	0.0022	29.6	Haloacid dehalogenase-like hydrolase
2	PF00702 Hydrolase	6.3e-12	57.8	haloacid dehalogenase-like hydrolase
3	PF13344 Hydrolase_6	1e-23	94.6	Haloacid dehalogenase-like hydrolase
4	PF13242 Hydrolase_like	1.6e-14	65.0	HAD-hyrolase-like
5	PF09419 PGP_phosphatase	3.7	18.6	Mitochondrial PGP phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330918

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000313432	0.949	Glyoxylate reductase/hydroxypyruvate reductase
2	9606.ENSP00000368066	0.941	Hydroxyacid oxidase 1
3	9606.ENSP00000483507	0.934	Hydroxyacid oxidase 2
4	9606.ENSP00000377357	0.756	Palmitoyltransferase ZDHHC16
5	9606.ENSP00000308430	0.704	Cytochrome b5 type B
6	9606.ENSP00000420161	0.703	Beta-1,4-galactosyltransferase 4
7	9606.ENSP00000362463	0.700	Lactoylglutathione lyase
8	9606.ENSP00000321259	0.663	Transaldolase
9	9606.ENSP00000380514	0.646	Hydroxyacylglutathione hydrolase, mitochondrial
10	9606.ENSP00000207870	0.633	Xylulose kinase
11	9606.ENSP00000348170	0.609	Haptoglobin
12	9606.ENSP00000378854	0.549	Phosphoserine phosphatase
13	9606.ENSP00000229239	0.539	Glyceraldehyde-3-phosphate dehydrogenase
14	9606.ENSP00000378408	0.532	Alanine aminotransferase 1
15	9606.ENSP00000251595	0.511	Hemoglobin subunit alpha 2
16	9606.ENSP00000322421	0.511	Hemoglobin subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016791	1.000	phosphatase activity
GO:0005488	0.989	binding
GO:0005515	0.803	protein binding
GO:0043136	0.691	glycerol-3-phosphatase activity
GO:0043167	0.488	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0006796	0.997	phosphate-containing compound metabolic process
GO:0019751	0.995	polyol metabolic process
GO:0046165	0.995	alcohol biosynthetic process
GO:0046173	0.993	polyol biosynthetic process
GO:0006071	0.993	glycerol metabolic process
GO:0006629	0.980	lipid metabolic process
GO:0065007	0.956	biological regulation
GO:0050794	0.953	regulation of cellular process
GO:0016051	0.939	carbohydrate biosynthetic process
GO:0034637	0.924	cellular carbohydrate biosynthetic process
GO:0019637	0.900	organophosphate metabolic process
GO:0006644	0.875	phospholipid metabolic process
GO:0080090	0.865	regulation of primary metabolic process
GO:0031323	0.865	regulation of cellular metabolic process
GO:0010675	0.841	regulation of cellular carbohydrate metabolic process
GO:0062012	0.835	regulation of small molecule metabolic process
GO:0048519	0.815	negative regulation of biological process
GO:0048523	0.801	negative regulation of cellular process
GO:0046486	0.778	glycerolipid metabolic process
GO:0006650	0.729	glycerophospholipid metabolic process
GO:0062014	0.705	negative regulation of small molecule metabolic process
GO:0010906	0.705	regulation of glucose metabolic process
GO:0043255	0.703	regulation of carbohydrate biosynthetic process
GO:0045912	0.691	negative regulation of carbohydrate metabolic process
GO:0006111	0.691	regulation of gluconeogenesis
GO:0010677	0.649	negative regulation of cellular carbohydrate metabolic process
GO:0009890	0.380	negative regulation of biosynthetic process
GO:0006807	0.361	nitrogen compound metabolic process
GO:0031326	0.322	regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.850	organelle
GO:0043227	0.780	membrane-bounded organelle
GO:0043229	0.575	intracellular organelle
GO:0043231	0.515	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.

[back to server]