StarFunc result for job id A6NDR6

User Input

>input (274 residues)
MGPELGWGHPRGGDVCSSDSFNEDNTAFAKQVRSERPFFSSNPELDNLMIQAIQVLRFHL
LELEKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNIWIRDHEDSGSVHLGTPGPS
SGGLASQSGDNSSDQGVGLDTSVASPSSGGEDEDLDQEPRRNKKRGIFPKVATNIMRAWL
FQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEG
QPIGGYTETEPHVAFRAPASVGMSLNSEGEWHYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97368	0.300	0.222	1.271E-29	378	0.869	0.630	P97368.pdb.gz	MEIS3_MOUSE Homeobox protein Meis3 OS=Mus musculus OX=10090 GN=Meis3 PE=2 SV=2
2	AFDB:Q5U4X3	0.277	0.175	1.975E-25	453	0.723	0.437	Q5U4X3.pdb.gz	MEI3A_XENLA Homeobox protein meis3-A OS=Xenopus laevis OX=8355 GN=meis3-a PE=2 SV=1
3	AFDB:P79937	0.291	0.209	2.631E-23	390	0.701	0.492	P79937.pdb.gz	MEIS1_XENLA Homeobox protein Meis1 OS=Xenopus laevis OX=8355 GN=meis1 PE=1 SV=1
4	AFDB:Q90ZE3	0.284	0.193	9.237E-23	415	0.657	0.434	Q90ZE3.pdb.gz	Q90ZE3_DANRE Homeobox protein Meis3 OS=Danio rerio OX=7955 GN=NH10 PE=2 SV=1
5	AFDB:O14770	0.270	0.162	1.286E-22	477	0.679	0.390	O14770.pdb.gz	MEIS2_HUMAN Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=2
6	AFDB:A0A2R8QIZ3	0.288	0.180	5.504E-22	463	0.668	0.395	A0A2R8QIZ3.pdb.gz
7	AFDB:Q6NZT4	0.288	0.211	1.829E-20	380	0.599	0.432	Q6NZT4.pdb.gz
8	AFDB:O46339	0.279	0.161	2.183E-16	487	0.507	0.285	O46339.pdb.gz	HTH_DROME Homeobox protein homothorax OS=Drosophila melanogaster OX=7227 GN=hth PE=1 SV=1
9	AFDB:Q9N5D6	0.250	0.125	5.045E-12	564	0.420	0.204	Q9N5D6.pdb.gz	UNC62_CAEEL Homeobox protein unc-62 OS=Caenorhabditis elegans OX=6239 GN=unc-62 PE=1 SV=1
10	AFDB:O70477	0.250	0.158	6.645E-11	436	0.361	0.227	O70477.pdb.gz	PKNX1_MOUSE Homeobox protein PKNOX1 OS=Mus musculus OX=10090 GN=Pknox1 PE=1 SV=3
11	PDB:4egcA	0.161	0.085	2.891E-3	539	0.080	0.041	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.168	0.499	6.049E-2	73	0.058	0.219	2hi3A.pdb.gz
13	PDB:5mrc66	0.106	0.097	1.266	305	0.102	0.092	5mrc66.pdb.gz	The structure of the yeast mitochondrial ribosome.
14	PDB:1xdxA	0.085	0.161	1.445	114	0.040	0.096	1xdxA.pdb.gz
15	PDB:5gadi	0.171	0.113	1.445	450	0.047	0.029	5gadi.pdb.gz	Structures of the E. coli translating ribosome with SRP and its receptor and with the translocon.
16	PDB:5x3tA	0.066	0.220	1.445	70	0.073	0.286	5x3tA.pdb.gz
17	PDB:3femA	0.122	0.120	1.761	281	0.018	0.018	3femA.pdb.gz
18	PDB:5nr5A	0.150	0.333	1.761	113	0.047	0.115	5nr5A.pdb.gz
19	PDB:2cg4A	0.106	0.178	1.882	149	0.029	0.054	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
20	PDB:2ffhA	0.142	0.098	1.882	407	0.036	0.025	2ffhA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99687	0.0	510	375	0.934	0.683	MEIS3_HUMAN Homeobox protein Meis3 OS=Homo sapiens OX=9606 GN=MEIS3 PE=1 SV=3
2	P97368	1.70e-173	485	378	0.872	0.632	MEIS3_MOUSE Homeobox protein Meis3 OS=Mus musculus OX=10090 GN=Meis3 PE=2 SV=2
3	Q5U4X3	3.10e-127	371	453	0.704	0.426	MEI3A_XENLA Homeobox protein meis3-A OS=Xenopus laevis OX=8355 GN=meis3-a PE=2 SV=1
4	Q9DDE0	4.07e-117	343	393	0.693	0.483	Q9DDE0_DANRE Meis homeobox 2a OS=Danio rerio OX=7955 GN=meis2.1 PE=1 SV=1
5	Q90ZE3	1.28e-116	342	415	0.650	0.429	Q90ZE3_DANRE Homeobox protein Meis3 OS=Danio rerio OX=7955 GN=NH10 PE=2 SV=1
6	Q9PTM7	7.48e-116	340	393	0.690	0.481	Q9PTM7_DANRE Meis homeobox 2b OS=Danio rerio OX=7955 GN=meis2.1 PE=1 SV=1
7	A0A0H2UKR5	4.57e-115	337	390	0.712	0.500	A0A0H2UKR5_DANRE Homeobox protein Meis2 isoform X6 OS=Danio rerio OX=7955 GN=fa26d08 PE=1 SV=1
8	Q6PHK8	2.84e-113	333	397	0.712	0.491	Q6PHK8_DANRE Homeobox protein Meis2 OS=Danio rerio OX=7955 GN=meis2.2 PE=1 SV=1
9	A0A8I6AHY1	5.10e-113	333	400	0.712	0.487	A0A8I6AHY1_RAT Meis homeobox 2 OS=Rattus norvegicus OX=10116 GN=Meis2 PE=3 SV=1
10	D4A2T5	2.85e-112	333	469	0.664	0.388	D4A2T5_RAT Meis homeobox 2 OS=Rattus norvegicus OX=10116 GN=Meis2 PE=3 SV=3
11	O14770	4.93e-112	333	477	0.682	0.392	MEIS2_HUMAN Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=2
12	P97367	5.09e-112	333	477	0.682	0.392	MEIS2_MOUSE Homeobox protein Meis2 OS=Mus musculus OX=10090 GN=Meis2 PE=1 SV=2
13	P79937	1.37e-107	318	390	0.679	0.477	MEIS1_XENLA Homeobox protein Meis1 OS=Xenopus laevis OX=8355 GN=meis1 PE=1 SV=1
14	Q7SZP3	3.91e-106	315	380	0.631	0.455	Q7SZP3_DANRE Homeobox protein Meis1 OS=Danio rerio OX=7955 GN=meis4.1a PE=1 SV=1
15	Q90XH2	5.27e-106	314	388	0.672	0.474	Q90XH2_DANRE Homeobox protein Meis1 OS=Danio rerio OX=7955 GN=meis1 PE=1 SV=1
16	Q60954	2.36e-103	308	390	0.675	0.474	MEIS1_MOUSE Homeobox protein Meis1 OS=Mus musculus OX=10090 GN=Meis1 PE=1 SV=1
17	O00470	2.66e-103	308	390	0.675	0.474	MEIS1_HUMAN Homeobox protein Meis1 OS=Homo sapiens OX=9606 GN=MEIS1 PE=1 SV=1
18	B1WC31	5.00e-103	307	390	0.672	0.472	B1WC31_RAT Meis1 protein OS=Rattus norvegicus OX=10116 GN=Meis1 PE=2 SV=1
19	A0A0G2JT27	8.25e-103	306	381	0.653	0.470	A0A0G2JT27_RAT Meis homeobox 2 OS=Rattus norvegicus OX=10116 GN=Meis2 PE=3 SV=2
20	A0A8I6GMM6	2.88e-101	305	465	0.650	0.383	A0A8I6GMM6_RAT Meis homeobox 1 OS=Rattus norvegicus OX=10116 GN=Meis1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	3.2e-17	73.5	Homeobox KN domain
2	PF00046 Homeodomain	3.5e-05	34.9	Homeodomain
3	PF16493 Meis_PKNOX_N	6.5e-19	79.3	N-terminal of Homeobox Meis and PKNOX1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010375702.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010376452.1	0.588	PBX homeobox 2
2	61622.XP_010385022.1	0.585	PBX homeobox 4
3	61622.XP_010367971.1	0.557	Ubiquitin ligase protein which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N- terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.
4	61622.XP_010371661.1	0.557	PBX homeobox 1
5	61622.XP_010382081.1	0.557	E3 ubiquitin-protein ligase UBR1 isoform X1
6	61622.XP_010364175.1	0.553	PBX homeobox 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	0.999	sequence-specific DNA binding
GO:0003700	0.993	DNA-binding transcription factor activity
GO:1990837	0.992	sequence-specific double-stranded DNA binding
GO:0000981	0.981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.960	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000976	0.832	transcription cis-regulatory region binding
GO:0000987	0.702	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.651	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0060255	0.993	regulation of macromolecule metabolic process
GO:0050794	0.974	regulation of cellular process
GO:0010468	0.971	regulation of gene expression
GO:0051171	0.965	regulation of nitrogen compound metabolic process
GO:0031323	0.947	regulation of cellular metabolic process
GO:0080090	0.926	regulation of primary metabolic process
GO:0032502	0.892	developmental process
GO:0048518	0.836	positive regulation of biological process
GO:0006355	0.771	regulation of DNA-templated transcription
GO:0032501	0.700	multicellular organismal process
GO:0009987	0.581	cellular process
GO:0048856	0.547	anatomical structure development
GO:0048522	0.478	positive regulation of cellular process
GO:0010604	0.475	positive regulation of macromolecule metabolic process
GO:0051173	0.458	positive regulation of nitrogen compound metabolic process
GO:0007275	0.446	multicellular organism development
GO:1902680	0.438	positive regulation of RNA biosynthetic process
GO:0048519	0.437	negative regulation of biological process
GO:0045893	0.433	positive regulation of DNA-templated transcription
GO:0048523	0.388	negative regulation of cellular process
GO:0048731	0.363	system development
GO:0048513	0.345	animal organ development
GO:0050896	0.321	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.678	intracellular organelle lumen
GO:0005737	0.667	cytoplasm
GO:0031981	0.661	nuclear lumen
GO:0005829	0.310	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]