StarFunc result for job id A6NDY0

User Input

>input (278 residues)
MWPFPSRSLFPPPTQAWLQTVSSDPEAQGWGAWNETKEILGPEGGEGKEEKEEEEDAEED
QDGDAGFLLSLLEQENLAECPLPDQELEAIKMKVCAMEQAEGTPRPPGVQQQAEEEEGTA
AGQLLSPETVGCPLSGTPEEKVEADHRSVYVGNVDYGGSAEELEAHFSRCGEVHRVTILC
DKFSGHPKGYAYIEFATKGSVQAAVELDQSLFRGRVIKVLPKRTNFPGISSTDRGGLRGH
PGSRGAPFPHSGLQGRPRLRPQGQNRARGKFSPWFSPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5XFR0	0.415	0.422	1.928E-33	273	0.658	0.670	Q5XFR0.pdb.gz	EPAB2_MOUSE Embryonic polyadenylate-binding protein 2 OS=Mus musculus OX=10090 GN=Pabpn1l PE=2 SV=1
2	AFDB:Q6TY21	0.397	0.500	1.674E-22	218	0.406	0.518	Q6TY21.pdb.gz	EPA2B_XENLA Embryonic polyadenylate-binding protein 2-B OS=Xenopus laevis OX=8355 GN=Pabpn1l-b PE=1 SV=1
3	AFDB:Q28165	0.385	0.353	1.065E-20	306	0.435	0.395	Q28165.pdb.gz	PABP2_BOVIN Polyadenylate-binding protein 2 OS=Bos taurus OX=9913 GN=PABPN1 PE=1 SV=3
4	AFDB:Q9DDY9	0.395	0.372	1.592E-20	296	0.399	0.375	Q9DDY9.pdb.gz	PAB2A_XENLA Polyadenylate-binding protein 2-A OS=Xenopus laevis OX=8355 GN=pabpn1-a PE=2 SV=1
5	AFDB:Q7KNF2	0.363	0.445	3.164E-18	224	0.320	0.397	Q7KNF2.pdb.gz	PABP2_DROME Polyadenylate-binding protein 2 OS=Drosophila melanogaster OX=7227 GN=Pabp2 PE=1 SV=1
6	AFDB:Q93VI4	0.361	0.436	3.009E-16	227	0.295	0.361	Q93VI4.pdb.gz	PABN1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=PABN1 PE=1 SV=1
7	AFDB:O14327	0.351	0.571	1.836E-15	166	0.245	0.410	O14327.pdb.gz	PAB2_SCHPO Polyadenylate-binding protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pab2 PE=1 SV=1
8	AFDB:F4KBV3	0.364	0.380	1.791E-14	265	0.306	0.321	F4KBV3.pdb.gz	F4KBV3_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=PABN1 PE=1 SV=1
9	AFDB:Q9LX90	0.358	0.450	3.742E-14	217	0.263	0.336	Q9LX90.pdb.gz	PABN3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana OX=3702 GN=PABN3 PE=1 SV=1
10	AFDB:Q9FJN9	0.346	0.434	6.838E-14	220	0.263	0.332	Q9FJN9.pdb.gz	PABN2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana OX=3702 GN=PABN2 PE=1 SV=1
11	PDB:6qx91K	0.285	0.393	3.348E-9	201	0.122	0.169	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	PDB:5yzg1	0.259	0.296	4.268E-8	243	0.076	0.086	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
13	PDB:5oobB	0.282	0.501	7.800E-8	152	0.068	0.125	5oobB.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
14	PDB:7dvqY	0.277	0.531	1.090E-7	140	0.083	0.164	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
15	PDB:6g90B	0.284	0.403	1.333E-7	193	0.101	0.145	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
16	PDB:1hl6A	0.272	0.609	1.630E-7	119	0.097	0.227	1hl6A.pdb.gz
17	PDB:5xjcw	0.271	0.784	2.131E-7	91	0.079	0.242	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
18	PDB:6y53o	0.266	0.455	2.785E-7	160	0.072	0.125	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
19	PDB:6n7pY	0.279	0.536	5.819E-7	138	0.072	0.145	6n7pY.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
20	PDB:3lqvB	0.252	0.591	6.653E-7	115	0.065	0.157	3lqvB.pdb.gz	Branch Recognition by SF3b14

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5XFR0	2.01e-123	355	273	0.665	0.678	EPAB2_MOUSE Embryonic polyadenylate-binding protein 2 OS=Mus musculus OX=10090 GN=Pabpn1l PE=2 SV=1
2	Q28165	1.83e-53	177	306	0.367	0.333	PABP2_BOVIN Polyadenylate-binding protein 2 OS=Bos taurus OX=9913 GN=PABPN1 PE=1 SV=3
3	Q6TY21	1.98e-53	174	218	0.335	0.427	EPA2B_XENLA Embryonic polyadenylate-binding protein 2-B OS=Xenopus laevis OX=8355 GN=Pabpn1l-b PE=1 SV=1
4	Q86U42	2.87e-53	177	306	0.367	0.333	PABP2_HUMAN Polyadenylate-binding protein 2 OS=Homo sapiens OX=9606 GN=PABPN1 PE=1 SV=3
5	G3V7Z8	5.29e-53	176	302	0.367	0.338	G3V7Z8_RAT Poly(A) binding protein, nuclear 1 OS=Rattus norvegicus OX=10116 GN=Pabpn1 PE=1 SV=1
6	Q8CCS6	6.35e-53	176	302	0.367	0.338	PABP2_MOUSE Polyadenylate-binding protein 2 OS=Mus musculus OX=10090 GN=Pabpn1 PE=1 SV=3
7	Q804A5	1.32e-52	172	218	0.335	0.427	EPA2A_XENLA Embryonic polyadenylate-binding protein 2-A OS=Xenopus laevis OX=8355 GN=Pabpn1l-a PE=1 SV=1
8	Q9DDY9	3.98e-48	163	296	0.353	0.331	PAB2A_XENLA Polyadenylate-binding protein 2-A OS=Xenopus laevis OX=8355 GN=pabpn1-a PE=2 SV=1
9	Q7KNF2	1.06e-47	160	224	0.349	0.433	PABP2_DROME Polyadenylate-binding protein 2 OS=Drosophila melanogaster OX=7227 GN=Pabp2 PE=1 SV=1
10	A0A8I6A5F1	5.72e-43	150	320	0.345	0.300	A0A8I6A5F1_RAT Poly(A) binding protein, nuclear 1 OS=Rattus norvegicus OX=10116 GN=Pabpn1 PE=1 SV=1
11	O14327	1.11e-31	117	166	0.209	0.349	PAB2_SCHPO Polyadenylate-binding protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pab2 PE=1 SV=1
12	Q9LX90	7.87e-30	114	217	0.277	0.355	PABN3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana OX=3702 GN=PABN3 PE=1 SV=1
13	Q9FJN9	2.46e-29	112	220	0.230	0.291	PABN2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana OX=3702 GN=PABN2 PE=1 SV=1
14	Q93VI4	1.23e-27	108	227	0.252	0.308	PABN1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=PABN1 PE=1 SV=1
15	F4KBV3	4.27e-26	105	265	0.205	0.215	F4KBV3_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=PABN1 PE=1 SV=1
16	P40561	1.05e-19	87.8	250	0.183	0.204	SGN1_YEAST RNA-binding protein SGN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SGN1 PE=1 SV=1
17	A2A2V2	1.92e-11	65.9	408	0.108	0.074	A2A2V2_HUMAN RNA binding motif protein 34 (Fragment) OS=Homo sapiens OX=9606 GN=RBM34 PE=1 SV=1
18	O45713	1.96e-11	61.2	85	0.101	0.329	O45713_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rbm-3.2 PE=1 SV=1
19	P42696	2.08e-11	65.9	430	0.108	0.070	RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens OX=9606 GN=RBM34 PE=1 SV=2
20	Q38D96	3.63e-11	65.1	429	0.176	0.114	Q38D96_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4120 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	7e-12	56.3	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000408598

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216727	0.818	Polyadenylate-binding protein 2
2	9606.ENSP00000452479	0.800	BCL2L2-PABPN1 readthrough
3	9606.ENSP00000281589	0.726	Polyadenylate-binding protein 3
4	9606.ENSP00000308012	0.724	Polyadenylate-binding protein 5
5	9606.ENSP00000262577	0.694	Zinc finger CCCH domain-containing protein 3
6	9606.ENSP00000255136	0.673	Polyadenylate-binding protein 1-like
7	9606.ENSP00000332444	0.591	Cleavage stimulation factor subunit 2 tau variant
8	9606.ENSP00000362063	0.591	Cleavage stimulation factor subunit 2
9	9606.ENSP00000356520	0.585	ATP-dependent RNA helicase A
10	9606.ENSP00000366135	0.555	Exosome component 10
11	9606.ENSP00000266529	0.549	Zinc finger CCHC-type and RNA binding motif containing 1
12	9606.ENSP00000368341	0.545	RNA-binding protein 24
13	9606.ENSP00000313007	0.540	Polyadenylate-binding protein 1
14	9606.ENSP00000297071	0.535	Transformer-2 protein homolog alpha
15	9606.ENSP00000433071	0.504	RNA-binding protein 4B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003729	0.949	mRNA binding
GO:0003727	0.882	single-stranded RNA binding
GO:0070717	0.718	poly-purine tract binding
GO:0008143	0.317	poly(A) binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.991	organic substance metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0044238	0.988	primary metabolic process
GO:0010468	0.986	regulation of gene expression
GO:0050794	0.983	regulation of cellular process
GO:0016070	0.978	RNA metabolic process
GO:0051171	0.976	regulation of nitrogen compound metabolic process
GO:0080090	0.973	regulation of primary metabolic process
GO:0031323	0.971	regulation of cellular metabolic process
GO:0051246	0.803	regulation of protein metabolic process
GO:0048519	0.800	negative regulation of biological process
GO:0009892	0.782	negative regulation of metabolic process
GO:0010605	0.758	negative regulation of macromolecule metabolic process
GO:0010556	0.696	regulation of macromolecule biosynthetic process
GO:0031326	0.696	regulation of cellular biosynthetic process
GO:0010467	0.692	gene expression
GO:0019219	0.681	regulation of nucleobase-containing compound metabolic process
GO:0009894	0.591	regulation of catabolic process
GO:0051252	0.575	regulation of RNA metabolic process
GO:1903311	0.548	regulation of mRNA metabolic process
GO:0048518	0.516	positive regulation of biological process
GO:0010608	0.498	post-transcriptional regulation of gene expression
GO:0051172	0.491	negative regulation of nitrogen compound metabolic process
GO:0048522	0.490	positive regulation of cellular process
GO:0016071	0.487	mRNA metabolic process
GO:0009893	0.484	positive regulation of metabolic process
GO:0031329	0.466	regulation of cellular catabolic process
GO:0010604	0.466	positive regulation of macromolecule metabolic process
GO:0048523	0.461	negative regulation of cellular process
GO:0031324	0.443	negative regulation of cellular metabolic process
GO:0065009	0.425	regulation of molecular function
GO:0006396	0.425	RNA processing
GO:0006417	0.403	regulation of translation
GO:0051173	0.325	positive regulation of nitrogen compound metabolic process
GO:0044260	0.320	cellular macromolecule metabolic process
GO:0031325	0.314	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0031981	0.975	nuclear lumen
GO:0005654	0.968	nucleoplasm
GO:0005737	0.957	cytoplasm
GO:0032991	0.952	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]