StarFunc result for job id A6NDZ8

User Input

>input (208 residues)
MGEPAFTSFPSPPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRP
VTRIRSHPDNQVRRRKGDEHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAP
GTAGESLDRAGAERVRIPLEPTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQAR
RVKKARERLAKALQADRLARQAEMLTCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NE82	0.472	0.472	6.467E-29	208	0.995	0.995	A6NE82.pdb.gz	MB3L3_HUMAN Putative methyl-CpG-binding domain protein 3-like 3 OS=Homo sapiens OX=9606 GN=MBD3L3 PE=5 SV=1
2	AFDB:Q8WWY6	0.229	0.242	1.332E-7	194	0.346	0.371	Q8WWY6.pdb.gz	MB3L1_HUMAN Methyl-CpG-binding domain protein 3-like 1 OS=Homo sapiens OX=9606 GN=MBD3L1 PE=1 SV=2
3	AFDB:P9WHW9	0.112	0.066	7.191E-1	368	0.115	0.065	P9WHW9.pdb.gz	PPE68_MYCTU PPE family immunomodulator PPE68 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=PPE68 PE=1 SV=1
4	PDB:6f40W	0.100	0.095	1.307	218	0.111	0.106	6f40W.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
5	AFDB:Q9XYB7	0.117	0.059	1.344	560	0.130	0.048	Q9XYB7.pdb.gz	NHR8_CAEEL Nuclear hormone receptor family member nhr-8 OS=Caenorhabditis elegans OX=6239 GN=nhr-8 PE=2 SV=1
6	AFDB:Q1LUP2	0.113	0.046	1.441	645	0.120	0.039	Q1LUP2.pdb.gz	Q1LUP2_DANRE Adducin 3 (gamma) a OS=Danio rerio OX=7955 GN=add3 PE=1 SV=1
7	AFDB:F5H3K6	0.101	0.090	1.545	245	0.197	0.167	F5H3K6.pdb.gz	F5H3K6_HUMAN Spi-1 proto-oncogene OS=Homo sapiens OX=9606 GN=SPI1 PE=1 SV=1
8	AFDB:Q7SZH5	0.098	0.078	1.656	291	0.173	0.124	Q7SZH5.pdb.gz	Q7SZH5_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 GN=C/EBPbeta PE=2 SV=1
9	AFDB:Q9SN78	0.122	0.082	1.656	333	0.115	0.072	Q9SN78.pdb.gz	MYB94_ARATH Transcription factor MYB94 OS=Arabidopsis thaliana OX=3702 GN=MYB94 PE=1 SV=1
10	AFDB:Q3USH1	0.108	0.064	1.775	422	0.125	0.062	Q3USH1.pdb.gz	INSY2_MOUSE Inhibitory synaptic factor 2A OS=Mus musculus OX=10090 GN=Insyn2a PE=1 SV=1
11	AFDB:Q17381	0.140	0.071	1.903	506	0.149	0.061	Q17381.pdb.gz	PHA4_CAEEL Defective pharyngeal development protein 4 OS=Caenorhabditis elegans OX=6239 GN=pha-4 PE=1 SV=1
12	PDB:6tljS	0.096	0.068	2.444	293	0.058	0.041	6tljS.pdb.gz	A unique binding mode of Nek2A to the APC/C allows its ubiquitination during prometaphase.
13	PDB:7bt6w	0.131	0.148	3.709	182	0.082	0.093	7bt6w.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
14	PDB:7mqaNA	0.120	0.086	4.569	295	0.173	0.122	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:6ip52F	0.123	0.122	4.898	210	0.192	0.190	6ip52F.pdb.gz	HCV IRES Captures an Actively Translating 80S Ribosome.
16	PDB:7oyaL1	0.118	0.130	6.034	197	0.130	0.137	7oyaL1.pdb.gz	A molecular network of conserved factors keeps ribosomes dormant in the egg.
17	PDB:6ff4C	0.134	0.097	6.468	286	0.139	0.101	6ff4C.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
18	PDB:7d59Q	0.130	0.183	6.468	121	0.096	0.165	7d59Q.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NE82	2.34e-148	412	208	0.995	0.995	MB3L3_HUMAN Putative methyl-CpG-binding domain protein 3-like 3 OS=Homo sapiens OX=9606 GN=MBD3L3 PE=5 SV=1
2	Q8NHZ7	2.28e-144	402	208	0.976	0.976	MB3L2_HUMAN Methyl-CpG-binding domain protein 3-like 2 OS=Homo sapiens OX=9606 GN=MBD3L2 PE=1 SV=3
3	Q8WWY6	2.59e-31	115	194	0.361	0.387	MB3L1_HUMAN Methyl-CpG-binding domain protein 3-like 1 OS=Homo sapiens OX=9606 GN=MBD3L1 PE=1 SV=2
4	A0A8I6ANN7	2.09e-17	80.1	257	0.298	0.241	A0A8I6ANN7_RAT Methyl-CpG binding domain protein 3 OS=Rattus norvegicus OX=10116 GN=Mbd3 PE=1 SV=1
5	A0A8I6GL26	2.56e-17	79.7	262	0.288	0.229	A0A8I6GL26_RAT Methyl-CpG binding domain protein 3 OS=Rattus norvegicus OX=10116 GN=Mbd3 PE=1 SV=1
6	Q9Z2D8	3.11e-17	80.1	285	0.298	0.218	MBD3_MOUSE Methyl-CpG-binding domain protein 3 OS=Mus musculus OX=10090 GN=Mbd3 PE=1 SV=1
7	O95983	4.87e-17	79.3	291	0.269	0.192	MBD3_HUMAN Methyl-CpG-binding domain protein 3 OS=Homo sapiens OX=9606 GN=MBD3 PE=1 SV=1
8	B2RZ64	8.60e-17	79.0	308	0.288	0.195	B2RZ64_RAT Mbd3 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Mbd3 PE=2 SV=1
9	Q9UBB5	1.55e-16	79.0	411	0.288	0.146	MBD2_HUMAN Methyl-CpG-binding domain protein 2 OS=Homo sapiens OX=9606 GN=MBD2 PE=1 SV=1
10	F7EY92	1.98e-16	77.8	282	0.260	0.191	F7EY92_RAT Methyl-CpG binding domain protein 3 OS=Rattus norvegicus OX=10116 GN=Mbd3 PE=1 SV=3
11	B0BNM2	2.42e-16	78.6	412	0.284	0.143	B0BNM2_RAT Mbd2 protein OS=Rattus norvegicus OX=10116 GN=Mbd2 PE=2 SV=1
12	D4A986	2.44e-16	78.6	412	0.284	0.143	D4A986_RAT Methyl-CpG binding domain protein 2 OS=Rattus norvegicus OX=10116 GN=Mbd2 PE=1 SV=3
13	Q9Z2E1	3.84e-16	78.2	414	0.288	0.145	MBD2_MOUSE Methyl-CpG-binding domain protein 2 OS=Mus musculus OX=10090 GN=Mbd2 PE=1 SV=2
14	Q7ZZR0	3.03e-15	73.9	242	0.245	0.211	Q7ZZR0_DANRE Mbd3b protein OS=Danio rerio OX=7955 GN=mdb3b PE=1 SV=1
15	A0A2R8QPC3	4.55e-15	73.6	265	0.245	0.192	A0A2R8QPC3_DANRE Methyl-CpG binding domain protein 3b isoform X1 OS=Danio rerio OX=7955 GN=cb357 PE=1 SV=1
16	Q9V424	1.01e-10	61.2	226	0.202	0.186	Q9V424_DROME Methyl-CpG binding domain protein-like, isoform B OS=Drosophila melanogaster OX=7227 GN=MBD-like PE=1 SV=1
17	Q9VHB7	6.56e-10	59.7	339	0.202	0.124	Q9VHB7_DROME LD22928p OS=Drosophila melanogaster OX=7227 GN=MBD-like PE=1 SV=2
18	A0A0B4KGZ0	7.09e-10	59.7	340	0.202	0.124	A0A0B4KGZ0_DROME Methyl-CpG binding domain protein-like, isoform C OS=Drosophila melanogaster OX=7227 GN=MBD-like PE=1 SV=1
19	Q6P6Q2	3.9	30.8	576	0.062	0.023	K2C5_RAT Keratin, type II cytoskeletal 5 OS=Rattus norvegicus OX=10116 GN=Krt5 PE=1 SV=1
20	Q8IWW6	5.0	30.4	846	0.106	0.026	RHG12_HUMAN Rho GTPase-activating protein 12 OS=Homo sapiens OX=9606 GN=ARHGAP12 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16564 MBDa	5.1e-27	105.2	p55-binding region of Methyl-CpG-binding domain proteins MBD
2	PF14048 MBD_C	2.5e-13	61.9	C-terminal domain of methyl-CpG binding protein 2 and 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370801

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000467301	0.752	Olfactory receptor 4F17
2	9606.ENSP00000252840	0.641	Zinc finger protein 557
3	9606.ENSP00000264819	0.571	Mesoderm induction early response protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.399	nucleic acid binding
GO:0003677	0.379	DNA binding
GO:0043565	0.337	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.983	regulation of biological process
GO:0009987	0.974	cellular process
GO:0050794	0.965	regulation of cellular process
GO:0019222	0.891	regulation of metabolic process
GO:0071704	0.887	organic substance metabolic process
GO:0044238	0.880	primary metabolic process
GO:0006807	0.867	nitrogen compound metabolic process
GO:0060255	0.867	regulation of macromolecule metabolic process
GO:0043170	0.823	macromolecule metabolic process
GO:0051171	0.818	regulation of nitrogen compound metabolic process
GO:0080090	0.801	regulation of primary metabolic process
GO:0031323	0.654	regulation of cellular metabolic process
GO:0071840	0.563	cellular component organization or biogenesis
GO:0016043	0.529	cellular component organization
GO:0019219	0.489	regulation of nucleobase-containing compound metabolic process
GO:1901564	0.458	organonitrogen compound metabolic process
GO:0019538	0.452	protein metabolic process
GO:0010468	0.358	regulation of gene expression
GO:0016570	0.353	histone modification
GO:0009892	0.319	negative regulation of metabolic process
GO:0048523	0.309	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005694	1.000	chromosome
GO:0005634	0.999	nucleus
GO:0032991	0.993	protein-containing complex
GO:0031981	0.985	nuclear lumen
GO:0005654	0.980	nucleoplasm
GO:0000785	0.970	chromatin
GO:0140513	0.948	nuclear protein-containing complex
GO:1902494	0.793	catalytic complex
GO:0000118	0.560	histone deacetylase complex
GO:0005667	0.528	transcription regulator complex
GO:0005737	0.358	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]