StarFunc result for job id A6NE01

User Input

>input (2351 residues)
MFFKMKNEIDNDPESEKCIKDSTIMRREPQNILSPLMLPNLEIPFSVKDIISRIERAQLH
RAREDIDMQLSEIMNNVHRIMTRYTLVFNSSSERNVSLTEHKKKQRTNFLEKMATYAKTI
EIREKTLANILAWLEEWNDVLSEMTLMDVDEHHHWIAQMELLPDTLKAIENNVKILSRFS
TSFLDEKKKQKKKILSRGTLWKSWKERVIKRPSTARALRPDQMISDQLATNTKVSEIQGM
LQELIGTTMFSTLENNAIKYISSTIVNLSTALSMLNDELKCVNFQSSTVYAHETSEAEKE
LSLKIIRDLSNENEMLQQKLQDAEEKCEQLIRSKIVIEQLYAKLSTSSTLKVLPGPSPQS
SRAIIKVGDTEDNMDNILDKELENIVDEVQRKETKDSGIKWDSTISYTAQAERTPDLTEL
RQQPVASEDISEDSTKDNVSLKKGDFYQEDETDEYQSWKRSHKKATYVYETSGPNLSDNK
SGQKVSEAKPSQYYELQVLKKKRKEMKSFSEDKSKSPTEAKRKHLSLTETKSQGGKSGTS
MMMLEQFRKVKRESPFDKRPTAAEIKVEPTTESLDKEGKGEIRSLVEPLSMIQFDDTAEP
QKGKIKGKKHHISSGTITSKEEKTEEKEELTKQVKSHQLVKSLSRVAKETSESTRVLESP
DGKSEQSNLEEFQEAIMAFLKQKIDNIGKAFDKKTVPKEEELLKRAEAEKLGIIKAKMEE
YFQKVAETVTKILRKYKDTKKEEQVGEKPIKQKKVVSFMPGLHFQKSPISAKSESSTLLS
YESTDPVINNLIQMILAEIESERDIPTVSTVQKDHKEKEKQRQEQYLQEGQEQMSGMSLK
QQLLGERNLLKEHYEKISENWEEKKAWLQMKEGKQEQQSQKQWQEEEMWKEEQKQATPKQ
AEQEEKQKQRGQEEEELPKSSLQRLEEGTQKMKTQGLLLEKENGQMRQIQKEAKHLGPHR
RREKGKEKQKPERGLEDLERQIKTKDQMQMKETQPKELEKMVIQTPMTLSPRWKSVLKDV
QRSYEGKEFQRNLKTLENLPDEKEPISITPPPSLQYSLPGALPISGQPLTKCIHLTPQQA
QEVGITLTPQQAQAQGITLTLQQAQELGIPLTPQQAQALEILFTPQQAQALGIPLTPQQT
QVQGITLTPQQDQAPGISLTTQQAQKLGIPLTPQQAQALGIPLTPQQAQELGIPLTPQQA
QALRVSLTPQQAQELGIPLTPQQAQALGITLTLQQAQQLGIPLTPQQAQALGITLTPKQV
QELGIPLTPQQAQALGITLTPKQAQELGIPLNPQQAQTLGIPLTPKQAQALGIPFTPQQA
QALGIPLTPQQAQTQEITLTPQQAQALGMPLTTQQAQELGIPLTPQHAQALGMPLTTQQA
QELGIPLTPQQAQALGMPLTTQQAQELGIPLTPQQAQELGIPFTPQQAQAQEITLTPQQA
QALGMPLTAQQAQELGITLTPQQAQELGIPLTPQQAQALGIPLIPPQAQELGIPLTPQQA
QALGILLIPPQAQELGIPLTPQQAQALGIPLIPPQAQELGIPLTPQQVQALGIPLIPPQA
QELEIPLTPQQAQALGIPLTPQQAQELGIPLTPQQAQELGIPLTPQQAQAQGIPLTPQQA
QALGISLTPQQAQAQGITLTPQQAQALGVPITPVNAWVSAVTLTSEQTHALESPMNLEQA
QEQLLKLGVPLTLDKAHTLGSPLTLKQVQWSHRPFQKSKASLPTGQSIISRLSPSLRLSL
ASSAPTAEKSSIFGVSSTPLQISRVPLNQGPFAPGKPLEMGILSEPGKLGAPQTLRSSGQ
TLVYGGQSTSAQFPAPQAPPSPGQLPISRAPPTPGQPFIAGVPPTSGQIPSLWAPLSPGQ
PLVPEASSIPGDLLESGPLTFSEQLQEFQPPATAEQSPYLQAPSTPGQHLATWTLPGRAS
SLWIPPTSRHPPTLWPSPAPGKPQKSWSPSVAKKRLAIISSLKSKSVLIHPSAPDFKVAQ
VPFTTKKFQMSEVSDTSEETQILRDTFAIESFRTFQSHFTKYRTPVYQTPYTDERALLTL
MKPTTSPSSLTTLLRTSQISPLEWYQKSRFPPIDKPWILSSVSDTKKPKVMVPPSSPQEL
EEKRYFVDVEAQKKNLILLNQAIKTCGLPSQLHTMARTLIIEILHMDTVQLGYLFRKYIA
YRLIQHARNNIMKRLKAIQNTGKGYEARNLHMMLSRLDDYGKKVMQVWTEKQKSLGQKRN
QCLKKMIHVFNQLKKIHELNLSQPIPLIIEEKQIPASTTFVQKPFLKLLMEEDRTSDICK
KFRQQEDQTEAIWNVDLSTSSYPIAEKTSMHSLWAQLGGYPDIPRLLQLEVQSTFRKSLA
SLQSRVKKIPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9QAT4	0.034	0.034	2.916E-3	2357	0.093	0.092	E9QAT4.pdb.gz	SC16A_MOUSE Protein transport protein Sec16A OS=Mus musculus OX=10090 GN=Sec16a PE=1 SV=1
2	AFDB:Q55GF9	0.031	0.049	2.016E-2	1320	0.070	0.124	Q55GF9.pdb.gz	ICPA_DICDI Inner centromere protein A OS=Dictyostelium discoideum OX=44689 GN=icpA PE=1 SV=1
3	AFDB:Q57Y65	0.038	0.051	2.206E-2	1617	0.093	0.135	Q57Y65.pdb.gz	Q57Y65_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.15M23.280 PE=4 SV=1
4	AFDB:F4IN78	0.027	0.040	3.160E-2	1366	0.080	0.138	F4IN78.pdb.gz	HUAL2_ARATH Protein HUA2-LIKE 2 OS=Arabidopsis thaliana OX=3702 GN=HULK2 PE=2 SV=2
5	AFDB:Q9LEY4	0.022	0.031	3.957E-2	1445	0.089	0.145	Q9LEY4.pdb.gz	HUAL1_ARATH Protein HUA2-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=HULK1 PE=2 SV=1
6	AFDB:Q80UK7	0.029	0.090	7.426E-2	654	0.034	0.124	Q80UK7.pdb.gz	SAS6_MOUSE Spindle assembly abnormal protein 6 homolog OS=Mus musculus OX=10090 GN=Sass6 PE=2 SV=2
7	PDB:6sgaF7	0.029	0.065	1.060E-1	662	0.027	0.095	6sgaF7.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
8	AFDB:Q6P9F0	0.034	0.101	1.218E-1	684	0.046	0.159	Q6P9F0.pdb.gz	CCD62_HUMAN Coiled-coil domain-containing protein 62 OS=Homo sapiens OX=9606 GN=CCDC62 PE=1 SV=2
9	AFDB:Q13023	0.035	0.035	1.274E-1	2319	0.103	0.104	Q13023.pdb.gz	AKAP6_HUMAN A-kinase anchor protein 6 OS=Homo sapiens OX=9606 GN=AKAP6 PE=1 SV=3
10	AFDB:Q9WVC7	0.028	0.028	1.458E-1	2314	0.101	0.103	Q9WVC7.pdb.gz	AKAP6_RAT A-kinase anchor protein 6 OS=Rattus norvegicus OX=10116 GN=Akap6 PE=1 SV=1
11	AFDB:P48415	0.031	0.032	1.525E-1	2195	0.089	0.096	P48415.pdb.gz	SEC16_YEAST COPII coat assembly protein SEC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC16 PE=1 SV=2
12	PDB:6swy8	0.025	0.106	4.471E-1	325	0.016	0.114	6swy8.pdb.gz
13	PDB:3lssA	0.040	0.186	5.117E-1	438	0.006	0.032	3lssA.pdb.gz	X-ray crystal structure of Seryl-tRNA synthetase from the eukaryotic parasite Trypanosoma brucei.
14	PDB:1serB	0.035	0.160	7.332E-1	421	0.009	0.050	1serB.pdb.gz	The 2.9 A crystal structure of T. thermophilus seryl-tRNA synthetase complexed with tRNA(Ser).
15	PDB:7nsuD	0.032	0.109	9.180E-1	420	0.006	0.033	7nsuD.pdb.gz
16	PDB:5o9zG	0.043	0.092	1.099	804	0.034	0.098	5o9zG.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
17	PDB:2b5uA	0.034	0.105	1.258	470	0.008	0.040	2b5uA.pdb.gz
18	PDB:5nugA	0.039	0.032	1.315	2920	0.006	0.005	5nugA.pdb.gz	Cryo-EM Reveals How Human Cytoplasmic Dynein Is Auto-inhibited and Activated.
19	PDB:7myoB	0.043	0.256	1.505	286	0.009	0.070	7myoB.pdb.gz	Cryo-EM structures of PI3K alpha reveal conformational changes during inhibition and activation.
20	PDB:7n58A	0.047	0.163	1.505	600	0.006	0.025	7n58A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IYM0	4.22e-37	155	893	0.046	0.120	F186B_HUMAN Protein FAM186B OS=Homo sapiens OX=9606 GN=FAM186B PE=2 SV=2
2	O96124	1.46e-26	122	2441	0.077	0.074	O96124_PLAF7 Erythrocyte membrane protein 3 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0201900 PE=4 SV=1
3	A0A509ASE5	9.65e-15	83.6	5367	0.017	0.008	A0A509ASE5_PLABA Protein SOC2 OS=Plasmodium berghei (strain Anka) OX=5823 GN=PBANKA_1442200 PE=4 SV=1
4	Q9HCI5	1.24e-06	56.6	957	0.027	0.066	MAGE1_HUMAN Melanoma-associated antigen E1 OS=Homo sapiens OX=9606 GN=MAGEE1 PE=1 SV=2
5	A0A8I5XWT0	8.63e-06	53.5	773	0.032	0.097	A0A8I5XWT0_RAT CD55 molecule (Cromer blood group) OS=Rattus norvegicus OX=10116 GN=Cd55 PE=1 SV=1
6	P14727	5.57e-04	47.8	1164	0.072	0.146	AVRB3_XANEU Avirulence protein AvrBs3 OS=Xanthomonas euvesicatoria OX=456327 GN=avrBs3 PE=1 SV=2
7	Q6XPR3	0.007	44.3	784	0.044	0.133	RPTN_HUMAN Repetin OS=Homo sapiens OX=9606 GN=RPTN PE=1 SV=1
8	Q4WXC4	0.030	41.6	430	0.025	0.135	Q4WXC4_ASPFU Cell surface protein, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G08990 PE=4 SV=1
9	Q6YJK1	0.41	38.5	1936	0.012	0.014	Q6YJK1_DANRE Atrial myosin heavy chain OS=Danio rerio OX=7955 GN=amhc PE=1 SV=1
10	P18583	0.57	38.1	2426	0.017	0.016	SON_HUMAN Protein SON OS=Homo sapiens OX=9606 GN=SON PE=1 SV=4
11	P49454	4.6	35.0	3114	0.013	0.010	CENPF_HUMAN Centromere protein F OS=Homo sapiens OX=9606 GN=CENPF PE=1 SV=3
12	Q02566	4.6	35.0	1938	0.010	0.012	MYH6_MOUSE Myosin-6 OS=Mus musculus OX=10090 GN=Myh6 PE=1 SV=2
13	P13533	6.0	34.7	1939	0.010	0.012	MYH6_HUMAN Myosin-6 OS=Homo sapiens OX=9606 GN=MYH6 PE=1 SV=5
14	P02564	6.7	34.7	1935	0.010	0.012	MYH7_RAT Myosin-7 OS=Rattus norvegicus OX=10116 GN=Myh7 PE=1 SV=2
15	P02563	6.8	34.7	1938	0.010	0.012	MYH6_RAT Myosin-6 OS=Rattus norvegicus OX=10116 GN=Myh6 PE=1 SV=2
16	Q91Z83	6.8	34.7	1935	0.010	0.012	MYH7_MOUSE Myosin-7 OS=Mus musculus OX=10090 GN=Myh7 PE=2 SV=1
17	P12883	6.9	34.7	1935	0.010	0.012	MYH7_HUMAN Myosin-7 OS=Homo sapiens OX=9606 GN=MYH7 PE=1 SV=5
18	F1QZW1	9.1	34.3	1938	0.010	0.012	F1QZW1_DANRE Myosin heavy chain 7 OS=Danio rerio OX=7955 GN=mg:cb02g011 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04442 CtaG_Cox11	1.1e+02	14.2	Cytochrome c oxidase assembly protein CtaG/Cox11
2	PF18071 HMW1C_N	7.8e+02	11.2	HMW1C N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329995

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308292	0.561	Protein FAM170B
2	9606.ENSP00000454407	0.556	Golgin subfamily A member 6-like protein 2
3	9606.ENSP00000308332	0.525	rRNA-processing protein UTP23 homolog
4	9606.ENSP00000301180	0.524	Disco interacting protein 2 homolog B
5	9606.ENSP00000339280	0.514	Coiled-coil domain containing 30
6	9606.ENSP00000428280	0.506	Fer-1-like protein 6
7	9606.ENSP00000367913	0.504	Putative protein FAM47C
8	9606.ENSP00000437968	0.504	HEAT repeat-containing protein 5A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.398	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.982	cellular process
GO:0065007	0.816	biological regulation
GO:0050789	0.735	regulation of biological process
GO:0050794	0.463	regulation of cellular process
GO:0048518	0.379	positive regulation of biological process
GO:0060294	0.358	cilium movement involved in cell motility
GO:0097722	0.355	sperm motility

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.998	intracellular organelle
GO:0043227	0.993	membrane-bounded organelle
GO:0043231	0.914	intracellular membrane-bounded organelle
GO:0043232	0.910	intracellular non-membrane-bounded organelle
GO:0005634	0.898	nucleus
GO:0005737	0.894	cytoplasm
GO:0005815	0.426	microtubule organizing center
GO:0005814	0.380	centriole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]