StarFunc result for job id A6NE52

User Input

>input (1622 residues)
MEAEVWEAEGYNLVLDSDLYDADGYDVPDPGLLTEKNELTFTEPSQVLPFLTSSQQWQSL
TPRARARRLWLLLRTSLHEVVEKEKRAELRAARLTHGLEPLRRLEVAAGLRSVAQDPVGG
RFVVLDGAGRLHLHKEDGWAQETLLAPVRLTGLVTVLGPLGAVGRFVGWGPAGLAILRPN
LSLLWLSEQGVGRAPGWAPTCCLPVPDLRLLLVAEMNSSLALWQFRSGGRRLVLRGSALH
PPPSPTGRLMRLAVAPVPPHHVLRCFAAYGSAVLTFDLHAWTLVDVRRDLHKTTISDLAY
CEEVEAMVTASRDSTVKVWEADWQIRMVFVGHTGPVTAMTVLPNTTLVLSASQDGTLRTW
DLQAAAQVGEVALGFWGQDKLSRRVGRLLAPVRPGWPVLSLCASSMQLWRVRELYSPLAQ
LPAKVLHVQVAPALPAPAHQSLPTRLVCACADGSVYLLSAATGRIVSSLLLEPEDCAAAV
AYCLPREALWLLTRAGHLVRANAARCPMSVLHRVCPPPPPAPQPCCLHLYSHLTDLEGAF
SSWEIVRQHWGELRCSSVACAWKNKNRYLPVVGHTDGTLSVLEWLSSKTVFQTEAHSPGP
VVAIASTWNSIVSSGGDLTVKMWRVFPYAEESLSLLRTFSCCYPAVALCALGRRVTAGFE
DPDSATYGLVQFGLGDSPRLDHRPQDDPTDHITGLCCCPTLKLYACSSLDCTVRIWTAEN
RLLRLLQLNGAPQALAFCSNSGDLVLALGSRLCLVSHRLYLPTSYLVKKMCRKAPDVVDD
PPLPLMSQESLTSAQLQRLTNLHGAASLSEALSLIHRRRATSQHLVPKEDLDAIVARDRD
LQQLRLGLVVPAAQPPPSWQQRQEGFDNYLRLIYGSGLLGMQSGRGSQQWSAGTLRVERE
TRDVCAVPQAAHCLARAEVSTAAQTVPTALSPQDLGALGQHFSQSPRVTVPIPPTHRRVH
SKASQLLARSSLSHYLGISLDLQLQLEQLRGRTTMALDLPSSHLQCRIPLLPKRWDKEPL
SSLRGFFPATVQPHKHCLRPICFPGYVPNSAVLQQMWLNAEPGASQDALWLWRPRPSQTQ
WQRKLLQWMGEKPGEEGEEDKKEEEEEKEDEELDWALASLSPHSNQQLDSWELEDQSAVD
WTQEPRRRSCKVARTHPHPWHRHGSLLLDEHYGHLPKFLHFFIYQTWFKKLFPIFSLQAY
PEAGTIEGLASLLVALLEKTTWVDRVHILQVLLRLLPNMSSDLQGQLQGLLVHLLNLDQP
PSLQDQTQKKFVILALQLLLACSLESRDVVLELMSYFLYSPVHCRPELKKLLHGLGLQDP
EGFLFKEMMTWVQGPDLDSKAGLRTCCHQKLEDMIQELQETPSQTSVVSGAPTRASVIPS
GTSWSASGIFGRLSQVSEVPLMVVSPAEPHSLAPELQAQRMLAPKRSWGTPQLRLRVLSE
TLKSFCLEPEARLHPAGPAQLPGEPPPLEETDWSHSQLLDLGPIDALNFFCEQLRAQQRS
SLQEKAAHPHPPEPYTVAPVPDMVVPPPREHWYHPILRLQEAKPQRSARSAMRLRGPMRS
RLCAGRTLDGPIRTLKLPLPRVEPQPFPLDWPMPPRPLPPRLLQPALQRYFLPADADPDT
YS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7mq8LR	0.162	0.326	1.616E-23	773	0.080	0.167	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
2	AFDB:M9PB01	0.172	0.125	1.262E-22	2397	0.118	0.080	M9PB01.pdb.gz	M9PB01_DROME WD repeat domain 62, isoform G OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
3	AFDB:F1LRR4	0.171	0.177	1.873E-22	1551	0.114	0.119	F1LRR4.pdb.gz	F1LRR4_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=4
4	PDB:7mq8LT	0.186	0.320	2.003E-22	869	0.060	0.113	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
5	PDB:5wyjBE	0.176	0.339	2.829E-22	753	0.060	0.129	5wyjBE.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
6	PDB:7d4iBE	0.177	0.296	3.804E-22	890	0.068	0.124	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
7	PDB:7d5sBE	0.185	0.316	7.975E-22	865	0.052	0.098	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
8	PDB:1nr0A	0.156	0.382	7.349E-21	610	0.056	0.149	1nr0A.pdb.gz
9	PDB:7mqaLQ	0.127	0.237	1.265E-20	830	0.060	0.117	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	PDB:7ajuUL	0.122	0.233	1.701E-20	779	0.067	0.140	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
11	PDB:6nd4Q	0.129	0.212	2.524E-20	862	0.072	0.135	6nd4Q.pdb.gz	Conformational switches control early maturation of the eukaryotic small ribosomal subunit.
12	PDB:6lqsBE	0.182	0.329	3.394E-20	823	0.061	0.120	6lqsBE.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
13	AFDB:Q9C0J8	0.102	0.122	1.131E-11	1336	0.091	0.110	Q9C0J8.pdb.gz	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
14	AFDB:O13637	0.166	0.215	9.303E-9	1224	0.092	0.123	O13637.pdb.gz	SEC31_SCHPO Protein transport protein sec31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec31 PE=1 SV=1
15	AFDB:Q92834	0.116	0.173	3.249E-7	1020	0.068	0.108	Q92834.pdb.gz	RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens OX=9606 GN=RPGR PE=1 SV=2
16	AFDB:Q8I418	0.114	0.087	3.768E-7	2606	0.105	0.065	Q8I418.pdb.gz	Q8I418_PLAF7 Guanidine nucleotide exchange factor OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0508500 PE=4 SV=1
17	AFDB:A0A0B4LEZ1	0.161	0.202	5.592E-7	1260	0.099	0.127	A0A0B4LEZ1.pdb.gz	A0A0B4LEZ1_DROME Secretory 31, isoform D OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=1 SV=1
18	AFDB:F1QM29	0.109	0.123	1.576E-6	1413	0.078	0.089	F1QM29.pdb.gz	F1QM29_DANRE Retinitis pigmentosa GTPase regulator b OS=Danio rerio OX=7955 GN=rpgrb PE=4 SV=1
19	AFDB:Q385F2	0.115	0.147	2.227E-6	1231	0.108	0.142	Q385F2.pdb.gz	Q385F2_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4040 PE=3 SV=1
20	AFDB:Q6P7E1	0.134	0.210	2.582E-6	968	0.073	0.123	Q6P7E1.pdb.gz	Q6P7E1_DANRE Semaphorin-6A precursor OS=Danio rerio OX=7955 GN=zgc:66106 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q54RP0	4.09e-08	60.5	648	0.013	0.032	AGTA_DICDI UDP-galactose:fucoside alpha-3-galactosyltransferase OS=Dictyostelium discoideum OX=44689 GN=agtA PE=1 SV=1
2	Q8I0F4	1.20e-06	55.5	419	0.028	0.107	LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum OX=44689 GN=lis1 PE=1 SV=1
3	Q12417	1.33e-06	55.1	451	0.026	0.093	PRP46_YEAST Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP46 PE=1 SV=1
4	P83774	1.34e-06	54.7	317	0.015	0.076	GBLP_CANAL Small ribosomal subunit protein RACK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ASC1 PE=1 SV=2
5	P87053	1.69e-06	55.1	605	0.020	0.053	POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof1 PE=1 SV=1
6	F7FLI5	3.28e-06	54.3	630	0.020	0.051	F7FLI5_RAT Katanin p80 WD40 repeat-containing subunit B1 OS=Rattus norvegicus OX=10116 GN=Katnb1 PE=3 SV=1
7	Q00664	7.31e-06	52.8	444	0.042	0.153	LIS1_EMENI Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=nudF PE=1 SV=1
8	Q8K450	9.36e-06	52.8	639	0.025	0.064	SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus OX=10090 GN=Spag16 PE=1 SV=1
9	Q10281	1.02e-05	52.0	314	0.015	0.080	GBLP_SCHPO Small ribosomal subunit protein RACK1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cpc2 PE=1 SV=3
10	Q9M2Z2	1.05e-05	51.6	317	0.014	0.073	WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana OX=3702 GN=WDR5A PE=1 SV=1
11	Q9CAA0	1.17e-05	52.8	920	0.029	0.051	COB21_ARATH Coatomer subunit beta'-1 OS=Arabidopsis thaliana OX=3702 GN=At1g79990 PE=2 SV=2
12	Q9BVA0	1.30e-05	52.4	655	0.021	0.052	KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens OX=9606 GN=KATNB1 PE=1 SV=1
13	Q8BG40	1.43e-05	52.4	658	0.021	0.052	KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus OX=10090 GN=Katnb1 PE=1 SV=1
14	Q4VFZ4	1.51e-05	52.0	655	0.021	0.052	Q4VFZ4_RAT Katanin p80 WD40 repeat-containing subunit B1 OS=Rattus norvegicus OX=10116 GN=Katnb1 PE=2 SV=1
15	A0A0G2JX20	1.54e-05	52.0	659	0.021	0.052	A0A0G2JX20_RAT Katanin p80 WD40 repeat-containing subunit B1 OS=Rattus norvegicus OX=10116 GN=Katnb1 PE=3 SV=2
16	P53622	1.61e-05	52.4	1201	0.027	0.037	COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COP1 PE=1 SV=2
17	B1WBN6	1.62e-05	52.0	640	0.021	0.053	B1WBN6_RAT Katnb1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Katnb1 PE=2 SV=1
18	P38123	1.64e-05	51.2	315	0.015	0.076	SWD3_YEAST COMPASS component SWD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SWD3 PE=1 SV=1
19	Q38C57	1.67e-05	51.6	433	0.018	0.069	Q38C57_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5990 PE=4 SV=1
20	O43818	1.71e-05	51.6	475	0.028	0.095	U3IP2_HUMAN U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens OX=9606 GN=RRP9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.0033	29.0	Anaphase-promoting complex subunit 4 WD40 domain
2	PF20426 NBCH_WD40	5.3e+02	10.8	Neurobeachin beta propeller domain
3	PF00400 WD40	1.8e-09	49.2	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320648

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000209728	0.853	Cell division control protein 6 homolog
2	9606.ENSP00000435565	0.831	Maestro heat like repeat family member 1
3	9606.ENSP00000301764	0.816	DNA damage-binding protein 1
4	9606.ENSP00000301019	0.787	DNA replication factor Cdt1
5	9606.ENSP00000454468	0.734	Transmembrane protein 249
6	9606.ENSP00000300738	0.706	Ribonucleoside-diphosphate reductase large subunit
7	9606.ENSP00000347206	0.683	Glycosylphosphatidylinositol anchor attachment 1 protein
8	9606.ENSP00000330098	0.643	F-box/LRR-repeat protein 6
9	9606.ENSP00000310547	0.638	Uncharacterized aarF domain-containing protein kinase 5
10	9606.ENSP00000436212	0.600	Zinc finger protein 707
11	9606.ENSP00000364589	0.578	Cullin-4A
12	9606.ENSP00000384109	0.578	Cullin-4B
13	9606.ENSP00000315476	0.577	Exosome complex component RRP41
14	9606.ENSP00000321320	0.563	Protein HGH1 homolog
15	9606.ENSP00000360623	0.558	Origin recognition complex subunit 1
16	9606.ENSP00000455711	0.558	Transcriptional repressor scratch 1
17	9606.ENSP00000434849	0.544	Leucine-rich repeat-containing protein 24
18	9606.ENSP00000292524	0.519	Leucine-rich repeat-containing protein 14
19	9606.ENSP00000436768	0.514	Solute carrier family 52, riboflavin transporter, member 2
20	9606.ENSP00000345024	0.503	GLI family zinc finger 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0065007	0.937	biological regulation
GO:0050789	0.931	regulation of biological process
GO:0071840	0.922	cellular component organization or biogenesis
GO:0016043	0.848	cellular component organization
GO:0050794	0.829	regulation of cellular process
GO:0006996	0.663	organelle organization
GO:0032502	0.580	developmental process
GO:0032501	0.576	multicellular organismal process
GO:0008152	0.493	metabolic process
GO:0071704	0.480	organic substance metabolic process
GO:0043170	0.415	macromolecule metabolic process
GO:0044085	0.393	cellular component biogenesis
GO:0006807	0.343	nitrogen compound metabolic process
GO:0044238	0.339	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0043229	1.000	intracellular organelle
GO:0005634	0.972	nucleus
GO:0005737	0.971	cytoplasm
GO:0070013	0.959	intracellular organelle lumen
GO:0032991	0.958	protein-containing complex
GO:0005829	0.954	cytosol
GO:0031981	0.954	nuclear lumen
GO:0043228	0.934	non-membrane-bounded organelle
GO:0043232	0.903	intracellular non-membrane-bounded organelle
GO:0005654	0.742	nucleoplasm
GO:0005856	0.391	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]