StarFunc result for job id A6NEQ2

User Input

>input (426 residues)
MAVQAALLSTHPFVPFGFGGSPDGLGGAFGALDKGCCFEDDETGAPAGALLSGAEGGDVR
EATRDLLSFIDSASSNIKLALDKPGKSKRKVNHRKYLQKQIKRCSGLMGAAPPGPPSPSA
ADTPAKRPLAAPSAPTVAAPAHGKAAPRREASQAAAAASLQSRSLAALFDSLRHVPGGAE
PAGGEVAAPAAGLGGAGTGGAGGDVAGPAGATAIPGARKVPLRARNLPPSFFTEPSRAGG
GGCGPSGPDVSLGDLEKGAEAVEFFELLGPDYGAGTEAAVLLAAEPLDVFPAGASVLRGP
PELEPGLFEPPPAVVGNLLYPEPWSVPGCSPTKKSPLTAPRGGLTLNEPLSPLYPAAADS
PGGEDGRGHLASFAPFFPDCALPPPPPPHQVSYDYSAGYSRTAYSSLWRSDGVWEGAPGE
EGAHRD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0A0MSI2	0.066	0.041	1.590E-2	830	0.200	0.102	A0A0A0MSI2.pdb.gz	A0A0A0MSI2_HUMAN Polyhomeotic homolog 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
2	AFDB:O82170	0.094	0.097	3.756E-2	402	0.167	0.177	O82170.pdb.gz	IKU1_ARATH Protein HAIKU1 OS=Arabidopsis thaliana OX=3702 GN=IKU1 PE=1 SV=1
3	AFDB:Q8AXX8	0.083	0.081	9.481E-2	446	0.134	0.128	Q8AXX8.pdb.gz	SOX10_XENLA Transcription factor Sox-10 OS=Xenopus laevis OX=8355 GN=sox10 PE=1 SV=1
4	AFDB:Q8IXK0	0.081	0.047	1.013E-1	858	0.171	0.085	Q8IXK0.pdb.gz	PHC2_HUMAN Polyhomeotic-like protein 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1
5	AFDB:Q7TMA2	0.083	0.060	1.082E-1	652	0.204	0.133	Q7TMA2.pdb.gz	ZN503_MOUSE Zinc finger protein 503 OS=Mus musculus OX=10090 GN=Znf503 PE=1 SV=1
6	AFDB:O35464	0.091	0.048	1.156E-1	1031	0.169	0.070	O35464.pdb.gz	SEM6A_MOUSE Semaphorin-6A OS=Mus musculus OX=10090 GN=Sema6a PE=1 SV=2
7	AFDB:P06536	0.070	0.045	1.235E-1	795	0.176	0.094	P06536.pdb.gz	GCR_RAT Glucocorticoid receptor OS=Rattus norvegicus OX=10116 GN=Nr3c1 PE=1 SV=2
8	AFDB:Q1RNF8	0.075	0.061	1.609E-1	542	0.190	0.149	Q1RNF8.pdb.gz	SAM11_MOUSE Sterile alpha motif domain-containing protein 11 OS=Mus musculus OX=10090 GN=Samd11 PE=2 SV=1
9	AFDB:A1Z6W3	0.080	0.034	2.097E-1	1299	0.218	0.072	A1Z6W3.pdb.gz	PRIC1_DROME Protein prickle OS=Drosophila melanogaster OX=7227 GN=pk PE=1 SV=1
10	AFDB:Q5ZQU2	0.097	0.058	2.097E-1	815	0.138	0.072	Q5ZQU2.pdb.gz	NPAS2_CHICK Neuronal PAS domain-containing protein 2 OS=Gallus gallus OX=9031 GN=NPAS2 PE=1 SV=1
11	PDB:6hivAg	0.074	0.106	6.141	259	0.038	0.062	6hivAg.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
12	PDB:7d4iBE	0.086	0.049	9.756	890	0.038	0.018	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N9Y4	7.48e-08	56.2	354	0.066	0.079	F181A_HUMAN Protein FAM181A OS=Homo sapiens OX=9606 GN=FAM181A PE=1 SV=3
2	O75962	0.009	41.2	3097	0.094	0.013	TRIO_HUMAN Triple functional domain protein OS=Homo sapiens OX=9606 GN=TRIO PE=1 SV=2
3	E5D6T0	1.3	34.3	2640	0.061	0.010	E5D6T0_MOUSE Bromodomain PHD finger transcription factor splice variant OS=Mus musculus OX=10090 GN=Bptf PE=2 SV=1
4	A2A655	1.5	33.9	2973	0.061	0.009	A2A655_MOUSE Bromodomain PHD finger transcription factor OS=Mus musculus OX=10090 GN=Bptf PE=1 SV=1
5	E9Q6A7	1.5	33.9	2921	0.061	0.009	E9Q6A7_MOUSE Bromodomain PHD finger transcription factor OS=Mus musculus OX=10090 GN=Bptf PE=1 SV=1
6	Q91WD0	1.6	33.5	569	0.082	0.062	GP108_MOUSE Protein GPR108 OS=Mus musculus OX=10090 GN=Gpr108 PE=1 SV=1
7	A2A654	1.8	33.5	3036	0.061	0.009	A2A654_MOUSE Bromodomain PHD finger transcription factor OS=Mus musculus OX=10090 GN=Bptf PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15238 FAM181	1.4e-24	99.1	FAM181

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365295

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352926	0.812	Transcriptional enhancer factor TEF-3
2	9606.ENSP00000288861	0.707	Calcium and integrin binding family member 4
3	9606.ENSP00000403683	0.698	SOSS complex subunit B2
4	9606.ENSP00000305675	0.660	Caveolae-associated protein 2
5	9606.ENSP00000466477	0.642	Testis-specific serine/threonine-protein kinase 6
6	9606.ENSP00000280258	0.551	Serine protease 23
7	9606.ENSP00000350222	0.543	Olfactory receptor 51D1
8	9606.ENSP00000342778	0.530	Protein phosphatase, Mg2+/Mn2+ dependent 1G
9	9606.ENSP00000485078	0.511	Olfactory receptor 52B4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.397	molecular function regulator activity
GO:0003824	0.397	catalytic activity
GO:0140677	0.345	molecular function activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.981	regulation of cellular process
GO:0019222	0.939	regulation of metabolic process
GO:0060255	0.868	regulation of macromolecule metabolic process
GO:0051171	0.857	regulation of nitrogen compound metabolic process
GO:0031323	0.856	regulation of cellular metabolic process
GO:0080090	0.847	regulation of primary metabolic process
GO:0009987	0.833	cellular process
GO:0019219	0.811	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.780	regulation of biosynthetic process
GO:0051252	0.756	regulation of RNA metabolic process
GO:0010468	0.747	regulation of gene expression
GO:0010556	0.720	regulation of macromolecule biosynthetic process
GO:0031326	0.673	regulation of cellular biosynthetic process
GO:0048518	0.622	positive regulation of biological process
GO:0045893	0.612	positive regulation of DNA-templated transcription
GO:0006357	0.439	regulation of transcription by RNA polymerase II
GO:0045944	0.336	positive regulation of transcription by RNA polymerase II
GO:0071704	0.322	organic substance metabolic process
GO:0044238	0.317	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.997	nucleus
GO:0031974	0.826	membrane-enclosed lumen
GO:0070013	0.822	intracellular organelle lumen
GO:0031981	0.667	nuclear lumen
GO:0005654	0.653	nucleoplasm
GO:0012505	0.342	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]