StarFunc result for job id A6NES4

User Input

>input (1674 residues)
MTEAITEAAVASSEEVSEERDDLGPLELHDSGTFQQVVNLLDIIDSESAKTDTTGAGLDM
RKTLASVIIMEKATTEPSVVINTLIRCLQVPEISTQRKVNIYNILQDIIQQEGELEEQCV
QRLVAIASKEMREIPEMEGYMKAEVASDTLVALSRNHFSLVMYELQHHLKPLNLTDEFVI
ITLAKLANGNVFEFMPYMGITLATIFTMLRLANEAKIRQAICSAMETFCETVQFYLKHLE
ESVYPVMTEEEFALKVFPMYRYFVTVWLRHYNPEVKLGVIKSLKPMLGLLLPNDDLREQV
YDYIPLLLAEYQGSLEVLFVTQVLRQILELSVTTNTPVPQMQLHTIFTELHVQVCNKAPA
QHQYSSQNLMEMVHCFVALARSYPKELMKFFFSQMETNKEAVRVGTLNLIRAIVSADEPR
MSIRAIYLAIRVVKNTISDTRSKVRMAILHIIGQLALCGYQERIKGWGLKYLSVQLTLST
YKLTNRREKFYQRDLEERMVHKVTMDTVKIITSSVSGMTTEFWVRLLCYIMETDYVEALT
PICISLTNLAEHQLHGQDVDVSVAGKSRQVDLPAPQKLLARLLVLMSSPYKGEGRGIAML
NLLRTLSQSIAPSMADMWELEIALLVRYLEEHTEFTWDQKAWEDKLIQFLRNSLKKTRGS
SWSLRLSKELNNQIASFDSPSLEKGFLYRALGFTLATGLEASKVEVLLLELLYKTDYSND
FDSEGVIMCFGLCARGQVKTVLNVLHDFEERIQESEQSWQISAWRKDHPWRRETVKSALM
VMYSCVASYCHPQLLLNLVDSPITAKIIHHYVSSCQDICLKMAFMKSVVQVTKAINNIKD
LEDFHFAQKTTLTSIIVAVIKAEPTDNLVSPVRALAMEALSHLSKLKPFYSTEENSELMD
ISIHSVISLQLPGEDNESIKTLYANALSSLEQLMESLLQRQLDPKGLQEMVQLLEKWILS
EKEWEREKAVSLHLYLMWIYVHSTAVCIHLKLGQFGTMVGLIAPCTCDAHQRTRMASMNV
LSSLLDLHASQTCSLWGPSKQKELEKCKGDLQSTDVEKIFCASSRIAKVVCMEFSCDEVV
SLIQKLCENTGAMNLQHDKASVTWIAFFLQMRAKELEDKVAEILSAILVHLPVVDHPEVR
RLLIDGILLLAHHHQETILTSLLRQPLPMESHLAEVWLAVSENVPFARTMLHSLMGRLQS
RLSPRISATSKADIWRLAAVDPLMTLCTIHLLIQKLDENDKLPDFLPDLIYTLLLQLGSS
HRPEAAPPVLKMWKLVHTTPLPEEMNLQRVTIKSMQLLFKRVKSQHLAHTLDEQAVWDLL
QDGGTFLEGVSLLARLCMQHVEGHRQRLAELVLRGMDSEVLSCRISSTAVCFMSGPVLYQ
EKLLKPAALLLEKGADQEEDEALRVLSLRALGNMALGAPKKVKQYRKVLLEKCLGPLREP
VSNSVTAEGMEALTKILAELREGDVGSSFDAMSEQCRIFFDNESELLRLKAFILFGKLAR
VVGMSKKHFFKGEVKKAWIPLMLHSQDPCSNAAQACMATMFQCVHFWGWKSLEHPSGPSD
TATDDKMTVFQTTMCSILTRKKPAVLYRFLLETMAYVKNNLSRIRIAACNLAGIIMKQMS
THYLKKLDFPALRNSLQELQLDPDPGVRRAALETLTVLDSCSQHGFLASPQGMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7M6Y6	0.429	0.451	1.760E-65	1581	0.277	0.293	Q7M6Y6.pdb.gz	MRO2B_MOUSE Maestro heat-like repeat-containing protein family member 2B OS=Mus musculus OX=10090 GN=Mroh2b PE=1 SV=2
2	AFDB:Q54F23	0.395	0.401	1.606E-48	1647	0.197	0.200	Q54F23.pdb.gz	MROH1_DICDI Maestro heat-like repeat-containing protein family member 1 OS=Dictyostelium discoideum OX=44689 GN=mroh1 PE=4 SV=1
3	AFDB:Q9W350	0.364	0.352	3.044E-41	1742	0.182	0.175	Q9W350.pdb.gz	Q9W350_DROME C11.1, isoform A OS=Drosophila melanogaster OX=7227 GN=c11.1 PE=1 SV=2
4	AFDB:F4IP13	0.359	0.351	6.514E-38	1716	0.167	0.163	F4IP13.pdb.gz	SHGR6_ARATH Protein SHOOT GRAVITROPISM 6 OS=Arabidopsis thaliana OX=3702 GN=SGR6 PE=2 SV=1
5	AFDB:Q68CQ1	0.365	0.444	9.340E-23	1323	0.111	0.140	Q68CQ1.pdb.gz	MROH7_HUMAN Maestro heat-like repeat-containing protein family member 7 OS=Homo sapiens OX=9606 GN=MROH7 PE=2 SV=4
6	AFDB:G3X8W1	0.328	0.534	2.909E-22	983	0.116	0.197	G3X8W1.pdb.gz	G3X8W1_MOUSE Maestro heat-like repeat family member 4 OS=Mus musculus OX=10090 GN=Mroh4 PE=1 SV=1
7	PDB:7mp6B	0.382	0.393	4.398E-15	1609	0.124	0.129	7mp6B.pdb.gz
8	AFDB:Q5VYK3	0.178	0.168	4.955E-15	1845	0.138	0.125	Q5VYK3.pdb.gz	ECM29_HUMAN Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2
9	PDB:7pgsN	0.370	0.353	3.447E-14	1787	0.121	0.114	7pgsN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
10	AFDB:Q9HDV6	0.360	0.287	3.884E-14	2196	0.135	0.103	Q9HDV6.pdb.gz	MOR2_SCHPO Cell polarity protein mor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mor2 PE=4 SV=1
11	AFDB:B3CJ34	0.158	0.114	9.107E-14	2634	0.151	0.096	B3CJ34.pdb.gz	B3CJ34_CAEEL TOG domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gcn-1 PE=1 SV=3
12	AFDB:Q10105	0.158	0.116	2.212E-13	2670	0.126	0.079	Q10105.pdb.gz	GCN1_SCHPO eIF-2-alpha kinase activator gcn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gcn1 PE=3 SV=1
13	PDB:6yejA	0.162	0.137	1.124E-11	2046	0.145	0.119	6yejA.pdb.gz
14	PDB:7mqaSP	0.188	0.149	1.983E-11	2485	0.144	0.097	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7r04B	0.236	0.190	9.801E-11	2229	0.148	0.111	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
16	PDB:6ez8A	0.163	0.123	1.257E-10	2353	0.153	0.109	6ez8A.pdb.gz
17	PDB:7mqaLM	0.174	0.157	1.669E-10	2041	0.143	0.118	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7pgrN	0.258	0.194	2.744E-10	2423	0.141	0.097	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
19	PDB:7mp5A	0.249	0.255	3.163E-10	1629	0.119	0.123	7mp5A.pdb.gz
20	PDB:6x9oA	0.156	0.115	5.582E-10	2425	0.159	0.110	6x9oA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7M6Y6	0.0	613	1581	0.284	0.301	MRO2B_MOUSE Maestro heat-like repeat-containing protein family member 2B OS=Mus musculus OX=10090 GN=Mroh2b PE=1 SV=2
2	Q54F23	1.08e-68	259	1647	0.201	0.204	MROH1_DICDI Maestro heat-like repeat-containing protein family member 1 OS=Dictyostelium discoideum OX=44689 GN=mroh1 PE=4 SV=1
3	F4IP13	1.36e-24	115	1716	0.115	0.112	SHGR6_ARATH Protein SHOOT GRAVITROPISM 6 OS=Arabidopsis thaliana OX=3702 GN=SGR6 PE=2 SV=1
4	Q14DS2	2.68e-24	113	914	0.113	0.207	Q14DS2_MOUSE 1700016M24Rik protein OS=Mus musculus OX=10090 GN=Mroh4 PE=2 SV=1
5	E9PZ22	4.40e-24	112	914	0.113	0.207	E9PZ22_MOUSE Maestro heat-like repeat family member 4 OS=Mus musculus OX=10090 GN=Mroh4 PE=1 SV=1
6	G3X8W1	5.42e-24	112	983	0.113	0.192	G3X8W1_MOUSE Maestro heat-like repeat family member 4 OS=Mus musculus OX=10090 GN=Mroh4 PE=1 SV=1
7	Q9DA96	6.00e-24	112	983	0.113	0.192	Q9DA96_MOUSE Maestro heat-like repeat family member 5 OS=Mus musculus OX=10090 GN=Mroh4 PE=2 SV=1
8	Q7TNB4	8.85e-22	98.6	248	0.036	0.242	MSTRO_MOUSE Protein maestro OS=Mus musculus OX=10090 GN=Mro PE=2 SV=1
9	Q9W350	7.67e-20	99.8	1742	0.081	0.077	Q9W350_DROME C11.1, isoform A OS=Drosophila melanogaster OX=7227 GN=c11.1 PE=1 SV=2
10	Q68CQ1	7.53e-17	89.7	1323	0.079	0.100	MROH7_HUMAN Maestro heat-like repeat-containing protein family member 7 OS=Homo sapiens OX=9606 GN=MROH7 PE=2 SV=4
11	Q9NHY0	5.78e-15	83.6	1407	0.084	0.100	Q9NHY0_DROME C11.1 (Fragment) OS=Drosophila melanogaster OX=7227 GN=c11.1 PE=4 SV=1
12	A0A5F8MPT5	2.74e-09	63.5	385	0.039	0.171	A0A5F8MPT5_MOUSE Maestro heat-like repeat family member 4 (Fragment) OS=Mus musculus OX=10090 GN=Mroh4 PE=1 SV=1
13	Q92621	4.4	34.7	2012	0.019	0.015	NU205_HUMAN Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3
14	Q04724	5.1	34.3	770	0.019	0.040	TLE1_HUMAN Transducin-like enhancer protein 1 OS=Homo sapiens OX=9606 GN=TLE1 PE=1 SV=2
15	Q62440	5.2	34.3	770	0.019	0.040	TLE1_MOUSE Transducin-like enhancer protein 1 OS=Mus musculus OX=10090 GN=Tle1 PE=1 SV=2
16	H0YNT2	5.3	34.3	716	0.019	0.043	H0YNT2_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
17	O13168	5.8	33.9	771	0.019	0.040	TLE3B_DANRE Transducin-like enhancer protein 3-B OS=Danio rerio OX=7955 GN=tle3b PE=1 SV=2
18	H0YKN8	6.0	33.9	778	0.019	0.040	H0YKN8_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
19	H0YKT5	6.0	33.9	774	0.019	0.040	H0YKT5_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
20	Q9JIT3	6.0	33.9	764	0.019	0.041	TLE3_RAT Transducin-like enhancer protein 3 OS=Rattus norvegicus OX=10116 GN=Tle3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12765 Cohesin_HEAT	6e+02	12.2	HEAT repeat associated with sister chromatid cohesion
2	PF02985 HEAT	0.23	22.8	HEAT repeat
3	PF13646 HEAT_2	1.6	20.5	HEAT repeats
4	PF13513 HEAT_EZ	59	15.6	HEAT-like repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477597

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356733	0.812	Maestro heat like repeat family member 9
2	9606.ENSP00000471417	0.601	Ankyrin repeat and death domain containing 1B
3	9606.ENSP00000290158	0.575	Importin subunit beta-1
4	9606.ENSP00000375859	0.509	Interferon induced transmembrane protein domain containing
5	9606.ENSP00000282032	0.503	ARL14 effector protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0065007	0.881	biological regulation
GO:0050794	0.798	regulation of cellular process
GO:0050896	0.797	response to stimulus
GO:0051716	0.708	cellular response to stimulus
GO:0008152	0.354	metabolic process
GO:0071704	0.339	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0070013	0.961	intracellular organelle lumen
GO:0016020	0.875	membrane
GO:0005634	0.800	nucleus
GO:0031982	0.750	vesicle
GO:0099503	0.710	secretory vesicle
GO:0030141	0.704	secretory granule
GO:0031981	0.431	nuclear lumen
GO:0005829	0.343	cytosol
GO:0005654	0.343	nucleoplasm
GO:0031090	0.341	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]