StarFunc result for job id A6NF36

User Input

>input (153 residues)
MEPLYQAGSILMTVNTLQGKKMIESGLQSGDFSLSQSWPSCLPPPADLEILQQKVAGVQR
ELEDFKKEALKSIHYLEDAFCEMNGALVQQEEQAARVRQRLREEEDRGIVRNKVLTFLLP
REKQLREHCKRLEDLLLDRGRDALRATKKSQAD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CJ78	0.138	0.025	8.721E-1	1038	0.085	0.013	Q8CJ78.pdb.gz	ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus OX=10090 GN=Znf628 PE=1 SV=2
2	AFDB:Q9H169	0.387	0.333	9.949E-1	189	0.144	0.116	Q9H169.pdb.gz	STMN4_HUMAN Stathmin-4 OS=Homo sapiens OX=9606 GN=STMN4 PE=1 SV=1
3	AFDB:Q5RIC7	0.368	0.319	1.383	188	0.163	0.133	Q5RIC7.pdb.gz	Q5RIC7_DANRE Stathmin OS=Danio rerio OX=7955 GN=wu:fj44e06 PE=3 SV=1
4	AFDB:Q8L9M8	0.183	0.197	1.577	138	0.052	0.058	Q8L9M8.pdb.gz	Q8L9M8_ARATH Uncharacterized protein At1g33810 OS=Arabidopsis thaliana OX=3702 GN=At1g33810 PE=1 SV=1
5	AFDB:F1NHV6	0.097	0.042	1.922	420	0.052	0.019	F1NHV6.pdb.gz	F1NHV6_CHICK YY2 transcription factor OS=Gallus gallus OX=9031 GN=YY2 PE=1 SV=2
6	AFDB:O70166	0.279	0.246	1.922	180	0.170	0.144	O70166.pdb.gz	STMN3_MOUSE Stathmin-3 OS=Mus musculus OX=10090 GN=Stmn3 PE=1 SV=1
7	AFDB:P21818	0.301	0.265	2.053	179	0.150	0.128	P21818.pdb.gz	STMN2_RAT Stathmin-2 OS=Rattus norvegicus OX=10116 GN=Stmn2 PE=1 SV=2
8	AFDB:Q03043	0.168	0.028	2.053	1088	0.065	0.009	Q03043.pdb.gz	KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster OX=7227 GN=for PE=1 SV=3
9	AFDB:Q3KR79	0.348	0.154	2.192	355	0.118	0.051	Q3KR79.pdb.gz	Q3KR79_RAT Atf1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Atf1 PE=2 SV=1
10	AFDB:A2ID27	0.273	0.190	2.671	234	0.170	0.111	A2ID27.pdb.gz	A2ID27_GOSHI MADS-box protein MADS7 OS=Gossypium hirsutum OX=3635 PE=2 SV=1
11	PDB:7ungi	0.183	0.113	3.971	250	0.052	0.032	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
12	PDB:3oeiB	0.127	0.202	4.530	91	0.052	0.088	3oeiB.pdb.gz
13	PDB:3sucA	0.101	0.026	4.530	767	0.039	0.008	3sucA.pdb.gz	Crystallographic Insights Into the Autocatalytic Assembly Mechanism of a Bacteriophage Tail Spike
14	PDB:6wr2N	0.107	0.084	4.530	197	0.013	0.010	6wr2N.pdb.gz	Structural basis of ClpXP recognition and unfolding of ssrA-tagged substrates.
15	PDB:2avoA	0.112	0.168	5.167	99	0.013	0.020	2avoA.pdb.gz	Kinetic, stability, and structural changes in high-resolution crystal structures of HIV-1 protease with drug-resistant mutations L24I, I50V, and G73S.
16	PDB:4c2kD	0.089	0.035	5.167	399	0.026	0.010	4c2kD.pdb.gz
17	PDB:3staA	0.096	0.078	5.519	189	0.013	0.011	3staA.pdb.gz
18	PDB:3j79Y	0.078	0.115	5.895	101	0.033	0.050	3j79Y.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
19	PDB:4fi3C	0.107	0.068	5.895	248	0.013	0.008	4fi3C.pdb.gz	Structure of AMP-PNP-bound vitamin B12 transporter BtuCD-F.
20	PDB:7rroa	0.285	0.262	6.296	169	0.150	0.136	7rroa.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9D9C6	1.45e-88	256	152	0.830	0.836	CC182_MOUSE Coiled-coil domain-containing protein 182 OS=Mus musculus OX=10090 GN=Ccdc182 PE=2 SV=1
2	Q9VHJ3	1.4	31.2	588	0.131	0.034	Q9VHJ3_DROME Enhancer of variegation 3-9 OS=Drosophila melanogaster OX=7227 GN=E(var)3-9 PE=1 SV=1
3	A8JUW5	1.5	31.2	2233	0.137	0.009	A8JUW5_DROME Narrow abdomen, isoform F OS=Drosophila melanogaster OX=7227 GN=na PE=4 SV=2
4	Q8I877	1.5	31.2	1910	0.137	0.011	Q8I877_DROME Alpha1U protein OS=Drosophila melanogaster OX=7227 GN=na PE=4 SV=1
5	R9PY25	1.5	31.2	2224	0.137	0.009	R9PY25_DROME Narrow abdomen, isoform G OS=Drosophila melanogaster OX=7227 GN=na PE=4 SV=2
6	Q9LFE4	2.0	30.8	853	0.144	0.026	Y5673_ARATH WEB family protein At5g16730, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g16730 PE=1 SV=1
7	O74562	2.3	30.8	1073	0.216	0.031	SEC8_SCHPO Exocyst complex component sec8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec8 PE=1 SV=2
8	Q5ASQ8	3.2	30.4	1501	0.170	0.017	Q5ASQ8_EMENI Phospholipid-transporting ATPase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN8672.2 PE=3 SV=1
9	Q9D952	3.5	30.0	2035	0.124	0.009	EVPL_MOUSE Envoplakin OS=Mus musculus OX=10090 GN=Evpl PE=1 SV=3
10	Q9LR44	5.4	29.6	469	0.111	0.036	U75B1_ARATH UDP-glycosyltransferase 75B1 OS=Arabidopsis thaliana OX=3702 GN=UGT75B1 PE=1 SV=1
11	F4HXL3	7.4	29.3	539	0.111	0.032	F4HXL3_ARATH Importin subunit alpha OS=Arabidopsis thaliana OX=3702 GN=IMPA-6 PE=1 SV=1
12	P18480	7.5	29.3	905	0.144	0.024	SNF5_YEAST SWI/SNF chromatin-remodeling complex subunit SNF5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNF5 PE=1 SV=3
13	Q9FWY7	7.5	28.9	538	0.111	0.032	IMPA6_ARATH Importin subunit alpha-6 OS=Arabidopsis thaliana OX=3702 GN=IMPA6 PE=1 SV=1
14	A0A087WPJ3	7.6	29.3	892	0.157	0.027	A0A087WPJ3_MOUSE Protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF),-interacting protein (liprin), alpha 4 (Fragment) OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
15	Q2YDP8	7.6	28.9	476	0.092	0.029	THNS2_DANRE Threonine synthase-like 2 OS=Danio rerio OX=7955 GN=thnsl2 PE=2 SV=1
16	Q8NHQ1	9.1	28.9	597	0.118	0.030	CEP70_HUMAN Centrosomal protein of 70 kDa OS=Homo sapiens OX=9606 GN=CEP70 PE=1 SV=2
17	Q688B2	9.3	28.9	1861	0.131	0.011	Q688B2_CAEEL Ion transport domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-77 PE=4 SV=1
18	Q688B3	9.3	28.9	1767	0.131	0.011	Q688B3_CAEEL Ion transport domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-77 PE=4 SV=2
19	Q688B4	9.3	28.9	1827	0.131	0.011	Q688B4_CAEEL Ion transport domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-77 PE=4 SV=2
20	Q6Q762	9.3	28.9	1831	0.131	0.011	Q6Q762_CAEEL Four domain-type voltage-gated ion channel alpha-1 subunit OS=Caenorhabditis elegans OX=6239 GN=nca-1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15835 DUF4715	6.7e-86	296.9	Domain of unknown function (DUF4715)
2	PF04102 SlyX	6.2e+02	12.4	SlyX
3	PF10212 TTKRSYEDQ	2.1e+02	12.3	Predicted coiled-coil domain-containing protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299415

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307958	0.697	IQ domain-containing protein F1
2	9606.ENSP00000225576	0.652	Trans-golgi network vesicle protein 23 homolog C
3	9606.ENSP00000265825	0.575	Fascin-3
4	9606.ENSP00000293303	0.571	Kelch-like protein 10
5	9606.ENSP00000344579	0.532	Fibrous sheath CABYR-binding protein
6	9606.ENSP00000356912	0.531	Spermatogenesis-associated protein 46
7	9606.ENSP00000361597	0.514	Spermatogenesis-associated protein 25
8	9606.ENSP00000325738	0.513	Nuclear transition protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0003006	0.992	developmental process involved in reproduction
GO:0032501	0.974	multicellular organismal process
GO:0048856	0.967	anatomical structure development
GO:0007548	0.944	sex differentiation
GO:0048513	0.941	animal organ development
GO:0048731	0.936	system development
GO:0046660	0.907	female sex differentiation
GO:0061458	0.903	reproductive system development
GO:0045137	0.848	development of primary sexual characteristics
GO:0009987	0.526	cellular process
GO:0050789	0.504	regulation of biological process
GO:0008406	0.502	gonad development
GO:0008585	0.487	female gonad development
GO:0050794	0.330	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.975	intracellular organelle
GO:0043227	0.902	membrane-bounded organelle
GO:0043228	0.849	non-membrane-bounded organelle
GO:0043232	0.819	intracellular non-membrane-bounded organelle
GO:0005829	0.610	cytosol
GO:0043231	0.578	intracellular membrane-bounded organelle
GO:0005856	0.418	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]