StarFunc result for job id A6NF83

User Input

>input (97 residues)
MEAPAERALPRLQALARPPPPISYEEELYDCLDYYYLRDFPACGAGRSKGRTRREQALRT
NWPAPGGHERKVAQKLLNGQRKRRQRQLHPKMRTRLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NF83	1.000	1.000	6.950E-17	97	1.000	1.000	A6NF83.pdb.gz	NUPR2_HUMAN Nuclear protein 2 OS=Homo sapiens OX=9606 GN=NUPR2 PE=2 SV=1
2	AFDB:A0A024QZC4	0.332	0.383	6.642E-3	82	0.309	0.366	A0A024QZC4.pdb.gz
3	AFDB:P36598	0.171	0.039	3.574	775	0.216	0.027	P36598.pdb.gz	THI1_SCHPO Thiamine repressible genes regulatory protein thi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=thi1 PE=1 SV=2
4	PDB:7w59R	0.170	0.075	3.678	280	0.175	0.061	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
5	PDB:6n7pA	0.196	0.109	4.515	186	0.196	0.102	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
6	AFDB:Q5TYU1	0.263	0.181	5.385	145	0.175	0.117	Q5TYU1.pdb.gz
7	AFDB:Q00916	0.192	0.079	5.766	300	0.196	0.063	Q00916.pdb.gz	RU17_YEAST U1 small nuclear ribonucleoprotein 70 kDa homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNP1 PE=1 SV=1
8	AFDB:Q62985	0.210	0.043	6.174	756	0.186	0.024	Q62985.pdb.gz	SH2B1_RAT SH2B adapter protein 1 OS=Rattus norvegicus OX=10116 GN=Sh2b1 PE=1 SV=1
9	PDB:7t3aC	0.193	0.060	6.355	406	0.134	0.032	7t3aC.pdb.gz	Cryo-EM structures of the human GATOR1-Rag-Ragulator complex reveal a spatial-constraint regulated GAP mechanism.
10	AFDB:Q9LT81	0.152	0.056	7.078	386	0.155	0.039	Q9LT81.pdb.gz	C3H39_ARATH Zinc finger CCCH domain-containing protein 39 OS=Arabidopsis thaliana OX=3702 GN=At3g19360 PE=2 SV=1
11	AFDB:Q9QY02	0.257	0.037	7.078	738	0.196	0.026	Q9QY02.pdb.gz	YTDC1_RAT YTH domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Ythdc1 PE=1 SV=2
12	AFDB:A0A0R4IN78	0.268	0.084	8.115	432	0.134	0.030	A0A0R4IN78.pdb.gz	A0A0R4IN78_DANRE Serine/threonine kinase 24b (STE20 homolog, yeast) OS=Danio rerio OX=7955 GN=stk24 PE=1 SV=1
13	AFDB:Q96M32	0.238	0.046	8.115	723	0.113	0.015	Q96M32.pdb.gz	KAD7_HUMAN Adenylate kinase 7 OS=Homo sapiens OX=9606 GN=AK7 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NF83	1.15e-66	197	97	1.000	1.000	NUPR2_HUMAN Nuclear protein 2 OS=Homo sapiens OX=9606 GN=NUPR2 PE=2 SV=1
2	O54842	3.86e-12	58.5	80	0.351	0.425	NUPR1_RAT Nuclear protein 1 OS=Rattus norvegicus OX=10116 GN=Nupr1 PE=2 SV=1
3	E9QCY4	5.29e-11	55.5	75	0.268	0.347	E9QCY4_DANRE Nuclear protein 1 OS=Danio rerio OX=7955 GN=fd46g12 PE=1 SV=1
4	Q9WTK0	1.57e-10	54.3	80	0.330	0.400	NUPR1_MOUSE Nuclear protein 1 OS=Mus musculus OX=10090 GN=Nupr1 PE=1 SV=1
5	O60356	3.49e-05	40.8	82	0.186	0.220	NUPR1_HUMAN Nuclear protein 1 OS=Homo sapiens OX=9606 GN=NUPR1 PE=1 SV=1
6	Q1RMZ1	0.81	30.4	405	0.216	0.052	SAMTR_HUMAN S-adenosylmethionine sensor upstream of mTORC1 OS=Homo sapiens OX=9606 GN=BMT2 PE=1 SV=1
7	Q980R1	0.91	30.4	1124	0.186	0.016	RPO2_SACS2 DNA-directed RNA polymerase subunit Rpo2 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=rpo2 PE=1 SV=2
8	B8YB55	0.92	30.4	1131	0.186	0.016	RPO2_SACSH DNA-directed RNA polymerase subunit Rpo2 OS=Saccharolobus shibatae OX=2286 GN=rpo2 PE=1 SV=1
9	U6C6H1	0.94	30.4	684	0.134	0.019	U6C6H1_9ACTN phospholipase C OS=Streptomyces sanglieri OX=193460 GN=gpc-cp PE=3 SV=1
10	P11513	1.4	29.6	1126	0.186	0.016	RPO2_SULAC DNA-directed RNA polymerase subunit Rpo2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=rpo2 PE=1 SV=2
11	P34607	3.0	28.9	910	0.124	0.013	MUT7_CAEEL Exonuclease mut-7 OS=Caenorhabditis elegans OX=6239 GN=mut-7 PE=1 SV=1
12	P14060	3.3	28.5	373	0.103	0.027	3BHS1_HUMAN 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 OS=Homo sapiens OX=9606 GN=HSD3B1 PE=1 SV=2
13	Q9UGM3	3.5	28.5	2413	0.175	0.007	DMBT1_HUMAN Deleted in malignant brain tumors 1 protein OS=Homo sapiens OX=9606 GN=DMBT1 PE=1 SV=2
14	Q8NHY3	6.9	27.7	880	0.206	0.023	GA2L2_HUMAN GAS2-like protein 2 OS=Homo sapiens OX=9606 GN=GAS2L2 PE=1 SV=1
15	Q7JN15	7.3	27.3	213	0.103	0.047	Q7JN15_DROME Musashi (Fragment) OS=Drosophila melanogaster OX=7227 GN=msi PE=4 SV=1
16	F4IUY8	9.3	27.3	1006	0.144	0.014	SAC3A_ARATH SAC3 family protein A OS=Arabidopsis thaliana OX=3702 GN=SAC3A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10195 Phospho_p8	6.5e-14	63.6	DNA-binding nuclear phosphoprotein p8

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000455442

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000276603	0.908	Telomeric repeat-binding factor 1
2	9606.ENSP00000378812	0.722	Coiled-coil-helix-coiled-coil-helix domain-containing protein 2
3	9606.ENSP00000263121	0.701	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
4	9606.ENSP00000275603	0.699	T-complex protein 1 subunit zeta
5	9606.ENSP00000363943	0.681	Tumor protein p53-inducible nuclear protein 2
6	9606.ENSP00000267415	0.652	TERF1-interacting nuclear factor 2
7	9606.ENSP00000341938	0.648	Sulfatase-modifying factor 2
8	9606.ENSP00000445440	0.645	Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform
9	9606.ENSP00000483946	0.587	PHD finger protein 19
10	9606.ENSP00000325738	0.567	Nuclear transition protein 2
11	9606.ENSP00000483117	0.567	Adrenocortical dysplasia protein homolog
12	9606.ENSP00000327191	0.540	T-complex protein 1 subunit zeta-2
13	9606.ENSP00000396896	0.515	DnaJ heat shock protein family member C4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.966	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0031324	0.983	negative regulation of cellular metabolic process
GO:0080090	0.979	regulation of primary metabolic process
GO:0051172	0.975	negative regulation of nitrogen compound metabolic process
GO:0019219	0.972	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.971	regulation of macromolecule biosynthetic process
GO:0031326	0.971	regulation of cellular biosynthetic process
GO:0010605	0.970	negative regulation of macromolecule metabolic process
GO:0050896	0.938	response to stimulus
GO:0006950	0.900	response to stress
GO:0045934	0.881	negative regulation of nucleobase-containing compound metabolic process
GO:0051716	0.877	cellular response to stimulus
GO:0010558	0.867	negative regulation of macromolecule biosynthetic process
GO:0031327	0.866	negative regulation of cellular biosynthetic process
GO:0071496	0.861	cellular response to external stimulus
GO:0051252	0.842	regulation of RNA metabolic process
GO:0010468	0.831	regulation of gene expression
GO:2001141	0.805	regulation of RNA biosynthetic process
GO:1903506	0.793	regulation of nucleic acid-templated transcription
GO:0006355	0.777	regulation of DNA-templated transcription
GO:0031668	0.776	cellular response to extracellular stimulus
GO:0006357	0.773	regulation of transcription by RNA polymerase II
GO:0031669	0.749	cellular response to nutrient levels
GO:0042594	0.662	response to starvation
GO:1903507	0.556	negative regulation of nucleic acid-templated transcription
GO:0045892	0.523	negative regulation of DNA-templated transcription
GO:0033554	0.511	cellular response to stress
GO:0048518	0.429	positive regulation of biological process
GO:0008152	0.387	metabolic process
GO:0009267	0.374	cellular response to starvation
GO:0048522	0.371	positive regulation of cellular process
GO:0044237	0.342	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.946	intracellular organelle lumen
GO:0031981	0.861	nuclear lumen
GO:0043232	0.711	intracellular non-membrane-bounded organelle
GO:0005654	0.699	nucleoplasm
GO:0032991	0.362	protein-containing complex
GO:0005737	0.313	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]