StarFunc result for job id A6NFD8

User Input

>input (242 residues)
MSDKLKERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQ
YLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILA
FLQSKARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGAGPFPWPP
GAARSPALPYLPSAPVPLASPAQQHSPFLTPVQGLDRHYLNLIGHAHPNALNLHTPQHPP
VL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TS99	0.357	0.360	2.562E-31	240	0.917	0.925	Q7TS99.pdb.gz	HELT_MOUSE Hairy and enhancer of split-related protein HELT OS=Mus musculus OX=10090 GN=Helt PE=1 SV=1
2	AFDB:A0A087WSW0	0.289	0.219	3.382E-30	327	0.967	0.716	A0A087WSW0.pdb.gz	A0A087WSW0_HUMAN Helt bHLH transcription factor OS=Homo sapiens OX=9606 GN=HELT PE=1 SV=1
3	AFDB:G3V7S6	0.238	0.174	3.757E-9	339	0.298	0.212	G3V7S6.pdb.gz	G3V7S6_RAT Hes-related family bHLH transcription factor with YRPW motif 2 OS=Rattus norvegicus OX=10116 GN=Hey2 PE=4 SV=1
4	AFDB:Q9I8A3	0.235	0.198	4.002E-9	294	0.298	0.245	Q9I8A3.pdb.gz	HEY1_XENLA Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Xenopus laevis OX=8355 GN=hey1 PE=1 SV=1
5	AFDB:Q9Y5J3	0.249	0.204	8.516E-9	304	0.343	0.273	Q9Y5J3.pdb.gz	HEY1_HUMAN Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Homo sapiens OX=9606 GN=HEY1 PE=1 SV=1
6	AFDB:Q9I9L0	0.236	0.181	1.812E-8	324	0.306	0.228	Q9I9L0.pdb.gz	HEY2_DANRE Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Danio rerio OX=7955 GN=hey2 PE=2 SV=2
7	AFDB:Q8AXV6	0.232	0.180	7.706E-8	317	0.302	0.230	Q8AXV6.pdb.gz	HEY1_DANRE Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Danio rerio OX=7955 GN=hey1 PE=2 SV=1
8	AFDB:Q9NQ87	0.234	0.177	2.392E-7	328	0.306	0.226	Q9NQ87.pdb.gz	HEYL_HUMAN Hairy/enhancer-of-split related with YRPW motif-like protein OS=Homo sapiens OX=9606 GN=HEYL PE=1 SV=2
9	AFDB:Q9DBX7	0.222	0.171	3.958E-7	326	0.314	0.233	Q9DBX7.pdb.gz	HEYL_MOUSE Hairy/enhancer-of-split related with YRPW motif-like protein OS=Mus musculus OX=10090 GN=Heyl PE=1 SV=2
10	AFDB:Q7KM13	0.231	0.141	8.423E-7	425	0.273	0.155	Q7KM13.pdb.gz	HEY_DROME Hairy/enhancer-of-split related with YRPW motif protein OS=Drosophila melanogaster OX=7227 GN=Hey PE=2 SV=1
11	PDB:7mq8LJ	0.129	0.075	3.157	469	0.054	0.028	7mq8LJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:4v8mAG	0.125	0.159	3.362	141	0.091	0.156	4v8mAG.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
13	PDB:3jcmI	0.111	0.070	4.605	416	0.050	0.029	3jcmI.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
14	PDB:7eebM	0.171	0.287	5.562	116	0.050	0.103	7eebM.pdb.gz	Structure of a mammalian sperm cation channel complex.
15	PDB:4kxrB	0.132	0.176	7.618	174	0.062	0.086	4kxrB.pdb.gz
16	PDB:6qw65B	0.139	0.027	8.113	2001	0.099	0.012	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
17	PDB:7pqcA	0.120	0.091	8.113	445	0.083	0.045	7pqcA.pdb.gz	A Structural Ensemble of a Tau-Microtubule Complex Reveals Regulatory Tau Phosphorylation and Acetylation Mechanisms.
18	PDB:7suk5	0.165	0.141	8.113	296	0.083	0.068	7suk5.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
19	PDB:5x3xQ	0.121	0.121	8.640	243	0.091	0.091	5x3xQ.pdb.gz
20	PDB:6yxxAI	0.103	0.104	8.640	240	0.062	0.062	6yxxAI.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WSW0	3.51e-165	461	327	0.967	0.716	A0A087WSW0_HUMAN Helt bHLH transcription factor OS=Homo sapiens OX=9606 GN=HELT PE=1 SV=1
2	Q7TS99	4.92e-161	447	240	0.917	0.925	HELT_MOUSE Hairy and enhancer of split-related protein HELT OS=Mus musculus OX=10090 GN=Helt PE=1 SV=1
3	Q9I8A3	5.53e-24	99.4	294	0.236	0.194	HEY1_XENLA Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Xenopus laevis OX=8355 GN=hey1 PE=1 SV=1
4	Q9WV93	1.19e-23	98.6	299	0.322	0.261	HEY1_MOUSE Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Mus musculus OX=10090 GN=Hey1 PE=1 SV=1
5	Q7KM13	5.69e-23	98.6	425	0.310	0.176	HEY_DROME Hairy/enhancer-of-split related with YRPW motif protein OS=Drosophila melanogaster OX=7227 GN=Hey PE=2 SV=1
6	Q9Y5J3	7.24e-23	96.7	304	0.244	0.194	HEY1_HUMAN Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Homo sapiens OX=9606 GN=HEY1 PE=1 SV=1
7	A0A8I5ZYX7	7.40e-22	95.9	617	0.244	0.096	A0A8I5ZYX7_RAT Hes-related family bHLH transcription factor with YRPW motif 1 OS=Rattus norvegicus OX=10116 GN=Hey1 PE=4 SV=1
8	Q8AXV6	1.75e-21	92.8	317	0.219	0.167	HEY1_DANRE Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Danio rerio OX=7955 GN=hey1 PE=2 SV=1
9	Q9I9L0	7.56e-21	91.3	324	0.202	0.151	HEY2_DANRE Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Danio rerio OX=7955 GN=hey2 PE=2 SV=2
10	Q9UBP5	1.25e-20	90.9	337	0.198	0.142	HEY2_HUMAN Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Homo sapiens OX=9606 GN=HEY2 PE=1 SV=1
11	G3V7S6	3.09e-20	89.7	339	0.198	0.142	G3V7S6_RAT Hes-related family bHLH transcription factor with YRPW motif 2 OS=Rattus norvegicus OX=10116 GN=Hey2 PE=4 SV=1
12	Q9QUS4	3.09e-20	89.7	339	0.198	0.142	HEY2_MOUSE Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Mus musculus OX=10090 GN=Hey2 PE=1 SV=1
13	Q9NQ87	3.96e-20	89.4	328	0.314	0.232	HEYL_HUMAN Hairy/enhancer-of-split related with YRPW motif-like protein OS=Homo sapiens OX=9606 GN=HEYL PE=1 SV=2
14	Q9DBX7	1.32e-18	85.1	326	0.190	0.141	HEYL_MOUSE Hairy/enhancer-of-split related with YRPW motif-like protein OS=Mus musculus OX=10090 GN=Heyl PE=1 SV=2
15	Q9DF41	4.07e-14	72.4	291	0.314	0.261	Q9DF41_DANRE BHLH-WRPW transcription factor OS=Danio rerio OX=7955 GN=wu:fc30a03 PE=2 SV=1
16	Q9VGZ5	4.14e-14	73.6	698	0.149	0.052	CWO_DROME Transcription factor cwo OS=Drosophila melanogaster OX=7227 GN=cwo PE=1 SV=2
17	Q90VV1	5.04e-14	71.6	277	0.190	0.166	HES4B_XENLA Transcription factor HES-4-B OS=Xenopus laevis OX=8355 GN=hes4-b PE=1 SV=1
18	Q2PGD2	7.36e-14	72.4	421	0.161	0.093	Q2PGD2_DANRE BHLH protein DEC2 OS=Danio rerio OX=7955 GN=bhlhb3l PE=2 SV=1
19	Q6XLQ0	1.24e-13	70.9	290	0.190	0.159	Q6XLQ0_CHICK C-hairy1A OS=Gallus gallus OX=9031 GN=hairy1 PE=1 SV=1
20	O57337	1.80e-13	70.5	290	0.190	0.159	HES1_CHICK Transcription factor HES-1 OS=Gallus gallus OX=9031 GN=HES1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18984 DUF5717_N	1.7e+02	11.5	Family of unknown function (DUF5717)N-terminal
2	PF07527 Hairy_orange	1.6e-05	36.3	Hairy Orange
3	PF00010 HLH	6.7e-14	62.9	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000426033

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230671	0.834	Sodium-dependent proline transporter
2	9606.ENSP00000311257	0.665	Storkhead-box protein 2
3	9606.ENSP00000246912	0.664	Max-like protein X
4	9606.ENSP00000468969	0.591	Protein Asterix
5	9606.ENSP00000215057	0.573	Myeloid zinc finger 1
6	9606.ENSP00000320794	0.552	Basic helix-loop-helix domain-containing protein USF3
7	9606.ENSP00000293883	0.515	GATOR complex protein WDR24

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001227	1.000	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.978	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0042802	0.937	identical protein binding
GO:0008134	0.564	transcription factor binding
GO:0046983	0.495	protein dimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0006355	0.990	regulation of DNA-templated transcription
GO:0009987	0.981	cellular process
GO:0048519	0.978	negative regulation of biological process
GO:0048523	0.957	negative regulation of cellular process
GO:0048518	0.955	positive regulation of biological process
GO:0006357	0.936	regulation of transcription by RNA polymerase II
GO:0045892	0.895	negative regulation of DNA-templated transcription
GO:0048522	0.868	positive regulation of cellular process
GO:0032502	0.862	developmental process
GO:0032501	0.855	multicellular organismal process
GO:0009893	0.847	positive regulation of metabolic process
GO:0048856	0.839	anatomical structure development
GO:0010604	0.836	positive regulation of macromolecule metabolic process
GO:0010557	0.805	positive regulation of macromolecule biosynthetic process
GO:0000122	0.779	negative regulation of transcription by RNA polymerase II
GO:0031328	0.759	positive regulation of cellular biosynthetic process
GO:1902680	0.708	positive regulation of RNA biosynthetic process
GO:0007275	0.696	multicellular organism development
GO:1903508	0.576	positive regulation of nucleic acid-templated transcription
GO:0045893	0.574	positive regulation of DNA-templated transcription
GO:0048731	0.569	system development
GO:0050896	0.410	response to stimulus
GO:0045944	0.388	positive regulation of transcription by RNA polymerase II
GO:0044237	0.356	cellular metabolic process
GO:0071704	0.353	organic substance metabolic process
GO:0044238	0.353	primary metabolic process
GO:0006807	0.322	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.993	protein-containing complex
GO:0005667	0.966	transcription regulator complex
GO:0070013	0.951	intracellular organelle lumen
GO:0031981	0.942	nuclear lumen
GO:0005654	0.916	nucleoplasm
GO:0005737	0.336	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]