StarFunc result for job id A6NFH5

User Input

>input (140 residues)
MIDQLQGTWKSISCENSEDYMKELGIGRASRKLGRLAKPTVTISTDGDVITIKTKSIFKN
NEISFKLGEEFEEITPGGHKTKSKVTLDKESLIQVQDWDGKETTITRKLVDGKMVVESTV
NSVICTRTYEKVSSNSVSNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NFH5	1.000	1.000	5.120E-24	140	1.000	1.000	A6NFH5.pdb.gz	FBP12_HUMAN Fatty acid-binding protein 12 OS=Homo sapiens OX=9606 GN=FABP12 PE=2 SV=2
2	AFDB:P02689	0.932	0.988	1.291E-17	132	0.621	0.659	P02689.pdb.gz	MYP2_HUMAN Myelin P2 protein OS=Homo sapiens OX=9606 GN=PMP2 PE=1 SV=3
3	AFDB:A0A0K0MJN3	0.934	0.990	2.936E-17	132	0.579	0.614	A0A0K0MJN3.pdb.gz	FABP4_PYGPA Fatty acid-binding protein, adipocyte OS=Pygoscelis papua OX=30457 GN=FABP4 PE=1 SV=1
4	AFDB:P05413	0.941	0.990	4.428E-17	133	0.486	0.511	P05413.pdb.gz	FABPH_HUMAN Fatty acid-binding protein, heart OS=Homo sapiens OX=9606 GN=FABP3 PE=1 SV=4
5	AFDB:F1MHQ4	0.929	0.985	5.165E-17	132	0.564	0.598	F1MHQ4.pdb.gz	F1MHQ4_BOVIN Fatty acid binding protein 4, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=3 SV=2
6	PDB:3nr3A	0.935	0.969	6.319E-17	135	0.614	0.637	3nr3A.pdb.gz
7	AFDB:P24526	0.932	0.988	8.633E-17	132	0.586	0.621	P24526.pdb.gz	MYP2_MOUSE Myelin P2 protein OS=Mus musculus OX=10090 GN=Pmp2 PE=2 SV=2
8	AFDB:Q0Z7S8	0.934	0.990	1.007E-16	132	0.543	0.576	Q0Z7S8.pdb.gz	FABP9_HUMAN Fatty acid-binding protein 9 OS=Homo sapiens OX=9606 GN=FABP9 PE=1 SV=1
9	AFDB:O97788	0.930	0.986	1.302E-16	132	0.514	0.545	O97788.pdb.gz	FABP4_PIG Fatty acid-binding protein, adipocyte OS=Sus scrofa OX=9823 GN=FABP4 PE=1 SV=3
10	AFDB:P07483	0.939	0.988	1.302E-16	133	0.507	0.534	P07483.pdb.gz	FABPH_RAT Fatty acid-binding protein, heart OS=Rattus norvegicus OX=10116 GN=Fabp3 PE=1 SV=2
11	AFDB:P55053	0.933	0.967	1.371E-16	135	0.479	0.496	P55053.pdb.gz	FABP5_RAT Fatty acid-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Fabp5 PE=1 SV=3
12	PDB:5hz9A	0.931	0.965	4.930E-16	135	0.479	0.496	5hz9A.pdb.gz	Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors.
13	PDB:7yf1A	0.925	0.974	7.063E-16	133	0.507	0.534	7yf1A.pdb.gz
14	PDB:4azqA	0.927	0.954	1.012E-15	136	0.471	0.485	4azqA.pdb.gz	Crystallographic Study of Fabp5 as an Intracellular Endocannabinoid Transporter.
15	PDB:2qm9A	0.895	0.901	1.780E-15	139	0.500	0.504	2qm9A.pdb.gz	Structural Basis for Activation of Fatty Acid-binding Protein 4
16	PDB:3p6dA	0.921	0.928	2.301E-15	139	0.514	0.518	3p6dA.pdb.gz	Structural analysis of ibuprofen binding to human adipocyte fatty-acid binding protein (FABP4).
17	PDB:4a60A	0.910	0.903	2.423E-15	141	0.529	0.525	4a60A.pdb.gz
18	PDB:5bvsA	0.904	0.958	3.297E-15	132	0.579	0.614	5bvsA.pdb.gz	Structural basis for the ligand-binding specificity of fatty acid-binding proteins (pFABP4 and pFABP5) in gentoo penguin
19	PDB:7e25A	0.922	0.928	4.262E-15	139	0.450	0.453	7e25A.pdb.gz	Crystal structure of human brain-type fatty acid-binding protein FABP7 complexed with palmitic acid.
20	PDB:5ur9F	0.887	0.899	7.499E-15	138	0.479	0.486	5ur9F.pdb.gz	The Antinociceptive Agent SBFI-26 Binds to Anandamide Transporters FABP5 and FABP7 at Two Different Sites.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NFH5	7.53e-99	281	140	1.000	1.000	FBP12_HUMAN Fatty acid-binding protein 12 OS=Homo sapiens OX=9606 GN=FABP12 PE=2 SV=2
2	P02689	1.39e-56	174	132	0.621	0.659	MYP2_HUMAN Myelin P2 protein OS=Homo sapiens OX=9606 GN=PMP2 PE=1 SV=3
3	P24526	1.41e-53	167	132	0.586	0.621	MYP2_MOUSE Myelin P2 protein OS=Mus musculus OX=10090 GN=Pmp2 PE=2 SV=2
4	F1MHQ4	3.09e-53	166	132	0.564	0.598	F1MHQ4_BOVIN Fatty acid binding protein 4, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=3 SV=2
5	A0A0K0MJN3	4.02e-53	166	132	0.579	0.614	FABP4_PYGPA Fatty acid-binding protein, adipocyte OS=Pygoscelis papua OX=30457 GN=FABP4 PE=1 SV=1
6	P48035	1.03e-52	164	132	0.557	0.591	FABP4_BOVIN Fatty acid-binding protein, adipocyte OS=Bos taurus OX=9913 GN=FABP4 PE=2 SV=2
7	Q0Z7S8	1.30e-49	157	132	0.543	0.576	FABP9_HUMAN Fatty acid-binding protein 9 OS=Homo sapiens OX=9606 GN=FABP9 PE=1 SV=1
8	O97788	3.71e-49	155	132	0.514	0.545	FABP4_PIG Fatty acid-binding protein, adipocyte OS=Sus scrofa OX=9823 GN=FABP4 PE=1 SV=3
9	P05413	4.92e-47	150	133	0.486	0.511	FABPH_HUMAN Fatty acid-binding protein, heart OS=Homo sapiens OX=9606 GN=FABP3 PE=1 SV=4
10	P11404	8.41e-47	149	133	0.514	0.541	FABPH_MOUSE Fatty acid-binding protein, heart OS=Mus musculus OX=10090 GN=Fabp3 PE=1 SV=5
11	P15090	1.57e-46	149	132	0.521	0.553	FABP4_HUMAN Fatty acid-binding protein, adipocyte OS=Homo sapiens OX=9606 GN=FABP4 PE=1 SV=3
12	P07483	2.93e-46	148	133	0.507	0.534	FABPH_RAT Fatty acid-binding protein, heart OS=Rattus norvegicus OX=10116 GN=Fabp3 PE=1 SV=2
13	P04117	5.97e-46	147	132	0.514	0.545	FABP4_MOUSE Fatty acid-binding protein, adipocyte OS=Mus musculus OX=10090 GN=Fabp4 PE=1 SV=3
14	P55054	1.33e-44	144	132	0.500	0.530	FABP9_RAT Fatty acid-binding protein 9 OS=Rattus norvegicus OX=10116 GN=Fabp9 PE=1 SV=1
15	P70623	2.43e-44	143	132	0.493	0.523	FABP4_RAT Fatty acid-binding protein, adipocyte OS=Rattus norvegicus OX=10116 GN=Fabp4 PE=1 SV=3
16	Q05423	4.63e-44	142	132	0.479	0.508	FABP7_CHICK Fatty acid-binding protein, brain OS=Gallus gallus OX=9031 GN=FABP7 PE=2 SV=2
17	Q01469	5.87e-43	140	135	0.479	0.496	FABP5_HUMAN Fatty acid-binding protein 5 OS=Homo sapiens OX=9606 GN=FABP5 PE=1 SV=3
18	P55053	3.60e-42	138	135	0.479	0.496	FABP5_RAT Fatty acid-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Fabp5 PE=1 SV=3
19	O15540	1.28e-41	136	132	0.457	0.485	FABP7_HUMAN Fatty acid-binding protein, brain OS=Homo sapiens OX=9606 GN=FABP7 PE=1 SV=3
20	P55052	2.60e-41	135	135	0.464	0.481	FABP5_BOVIN Fatty acid-binding protein 5 OS=Bos taurus OX=9913 GN=FABP5 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00061 Lipocalin	2e-19	81.7	Lipocalin / cytosolic fatty-acid binding protein family
2	PF14651 Lipocalin_7	0.017	26.5	Lipocalin / cytosolic fatty-acid binding protein family
3	PF17619 SCVP	2.6e+02	13.8	Secreted clade V proteins

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353650

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244289	0.657	Hormone-sensitive lipase
2	9606.ENSP00000256104	0.657	Fatty acid-binding protein, adipocyte
3	9606.ENSP00000377549	0.654	Gastrotropin
4	9606.ENSP00000357465	0.627	Tudor domain-containing protein 10
5	9606.ENSP00000245206	0.561	Aspartate aminotransferase, mitochondrial
6	9606.ENSP00000442477	0.514	Acid-sensing ion channel 5
7	9606.ENSP00000358212	0.511	Uncharacterized protein C10orf82
8	9606.ENSP00000284425	0.502	ATP-binding cassette sub-family A member 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005504	1.000	fatty acid binding
GO:0005515	0.987	protein binding
GO:0036041	0.501	long-chain fatty acid binding
GO:0005215	0.496	transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.911	cellular process
GO:0008152	0.828	metabolic process
GO:0065007	0.826	biological regulation
GO:0071704	0.782	organic substance metabolic process
GO:0044238	0.741	primary metabolic process
GO:0044237	0.694	cellular metabolic process
GO:0050789	0.593	regulation of biological process
GO:0051179	0.440	localization
GO:0006810	0.434	transport
GO:0050794	0.415	regulation of cellular process
GO:0050896	0.402	response to stimulus
GO:0006869	0.340	lipid transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.993	cytosol
GO:0043226	0.942	organelle
GO:0043229	0.887	intracellular organelle
GO:0043227	0.835	membrane-bounded organelle
GO:0043231	0.572	intracellular membrane-bounded organelle
GO:0005886	0.341	plasma membrane
GO:0005615	0.305	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]