StarFunc result for job id A6NFI3

User Input

>input (1004 residues)
MAALHTTPDSPAAQLERAEDGSECDPDQEEEEEEEEKGEEVQEVEEEEEEIVVEEEEEGV
AEVVQDAQVEAVAEVEVEADVEEEDVKEVLAEEECPALGTQERLSRGGDAKSPVLQEKGL
QASRAPATPRDEDLEEEEEEEEDEDEDDLLTAGCQELVTFEDVAVYFSLEEWERLEADQR
GLYQEVMQENYGILVSLGYPIPKPDLIFRLEQGEEPWVPDSPRPEEGDIVTGVYTGAWFW
TDDIEDHEEEDDEDFLAEVAEEENEPPGLWSAAYGVGDVPGTWGPDDSDSAQTPEGWGPD
PGGLGVLADGSEAKPFLPGREPGANLLSPWAFPAAVAPPAGRPETTCDVCGKVFPHRSRL
AKHQRYHAAVKPFGCEECGKGFVYRSHLAIHQRTHTGEKPFPCPDCGKRFVYKSHLVTHR
RIHTGERPYRCAFCGAGFGRRSYLVTHQRTHTGERPYPCSHCGRSFSQSSALARHQAVHT
ADRPHCCPDCGQAFRLRADFQRHRRGGGCAEAGGDGPRREPGETAAAAGPEDTDPGPEGS
EVGEADGEAEAAAEEREEAAVAAPTPSGKVDPAPERRFLELGNGLGEGEGPSSHPLGFHF
PVHPKSWLHPDSFPILGLPDFRERLPVDGRPLPAPLGGPLSLVEGTGLACDPFGGGGAAG
GGGGLRAFGPAIGGLLAEPAPAALAEEESPWICSDCGKTFGRRAALAKHQRYHAGERPHR
CADCGKSFVYGSHLARHRRTHTGERPFPCPECGARFARGSHLAAHVRGHTGEKPFVCGVC
GAGFSRRAHLTAHGRAHTGERPYACGECGRRFGQSAALTRHQWAHAEEKPHRCPDCGKGF
GHSSDFKRHRRTHTGEKPFRCADCGRGFAQRSNLAKHRRGHTGERPFPCPECGKRFSQRS
VLVTHQRTHTGERPYACANCGRRFSQSSHLLTHMKTHRGATAAPGSGSAPAPAPKPEAAA
KGPSSAGPGERGSALLEFAGGTSFGSEHQAAFAGPSGAYREGVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75290	0.157	0.238	1.033E-47	641	0.241	0.378	O75290.pdb.gz	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
2	AFDB:Q9P0L1	0.200	0.258	1.735E-44	754	0.227	0.302	Q9P0L1.pdb.gz	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
3	AFDB:Q05481	0.237	0.202	6.805E-44	1191	0.240	0.202	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
4	AFDB:Q8TBZ5	0.163	0.284	2.266E-42	544	0.212	0.392	Q8TBZ5.pdb.gz	ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens OX=9606 GN=ZNF502 PE=1 SV=1
5	AFDB:Q96JL9	0.159	0.215	3.182E-35	665	0.209	0.316	Q96JL9.pdb.gz	ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens OX=9606 GN=ZNF333 PE=1 SV=3
6	AFDB:Q9UL36	0.111	0.062	4.818E-31	1845	0.227	0.124	Q9UL36.pdb.gz	ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens OX=9606 GN=ZNF236 PE=1 SV=2
7	AFDB:Q9BSG1	0.121	0.259	1.107E-30	425	0.180	0.426	Q9BSG1.pdb.gz	ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens OX=9606 GN=ZNF2 PE=1 SV=5
8	AFDB:O43309	0.152	0.232	2.864E-30	604	0.179	0.298	O43309.pdb.gz	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
9	AFDB:Q9H5H4	0.182	0.323	9.974E-30	540	0.200	0.372	Q9H5H4.pdb.gz	ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens OX=9606 GN=ZNF768 PE=1 SV=2
10	AFDB:Q9H7X3	0.191	0.418	3.129E-28	374	0.145	0.390	Q9H7X3.pdb.gz	ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens OX=9606 GN=ZNF696 PE=1 SV=2
11	PDB:3w5kB	0.056	0.289	9.379E-5	110	0.040	0.364	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6o9lQ	0.030	0.057	1.120	430	0.042	0.098	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
13	PDB:3j9qA	0.032	0.077	2.152	385	0.015	0.039	3j9qA.pdb.gz
14	PDB:7pmkQ	0.029	0.036	3.262	766	0.022	0.029	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
15	PDB:4btsA9	0.031	0.170	3.899	93	0.015	0.161	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
16	PDB:5c8dE	0.025	0.066	4.660	280	0.014	0.050	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
17	PDB:5gm6a	0.029	0.119	4.660	123	0.019	0.154	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
18	PDB:7ok0C	0.040	0.071	4.660	393	0.013	0.033	7ok0C.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
19	PDB:7zsb4	0.023	0.051	4.660	306	0.016	0.052	7zsb4.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
20	PDB:7dvqM	0.033	0.100	6.271	191	0.028	0.147	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P2J8	1.63e-134	428	865	0.273	0.317	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
2	Q05481	6.73e-123	405	1191	0.229	0.193	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
3	Q14587	2.90e-110	366	947	0.207	0.220	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
4	A0A0U1RQ46	4.92e-108	350	609	0.209	0.345	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
5	Q4V8A8	2.84e-106	346	633	0.233	0.370	ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus OX=10116 GN=Zfp90 PE=2 SV=1
6	Q61967	5.70e-105	343	636	0.227	0.358	ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus OX=10090 GN=Zfp90 PE=1 SV=1
7	O75290	1.13e-99	329	641	0.223	0.349	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
8	Q5TYW1	7.80e-99	337	1059	0.256	0.243	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
9	Q02386	7.46e-97	323	682	0.196	0.289	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
10	E9Q981	5.48e-96	319	636	0.198	0.313	E9Q981_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
11	A0A087WSF4	8.06e-96	318	635	0.198	0.313	A0A087WSF4_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
12	Q8WTR7	8.61e-96	325	871	0.193	0.223	ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens OX=9606 GN=ZNF473 PE=1 SV=1
13	F8WEC7	1.12e-95	324	859	0.193	0.226	F8WEC7_HUMAN Zinc finger protein 473 OS=Homo sapiens OX=9606 GN=ZNF473 PE=1 SV=1
14	Q9NYW8	7.97e-95	318	714	0.211	0.297	RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens OX=9606 GN=RBAK PE=1 SV=1
15	Q9C0F3	2.47e-94	309	470	0.136	0.291	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
16	Q5MCW4	6.01e-94	315	686	0.174	0.255	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
17	P15620	1.01e-91	306	580	0.184	0.319	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
18	Q9UII5	1.64e-89	305	783	0.178	0.229	ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens OX=9606 GN=ZNF107 PE=1 SV=1
19	Q6ZNG1	5.48e-89	302	722	0.183	0.255	ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens OX=9606 GN=ZNF600 PE=1 SV=2
20	Q9UJW8	9.57e-88	298	692	0.134	0.195	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11672 DUF3268	7	18.4	zinc-finger-containing domain
2	PF07754 HVO_2753_ZBP	47	15.2	Small zinc finger protein HVO_2753-like, Zn-binding pocket
3	PF01352 KRAB	1.4e-17	74.3	KRAB box
4	PF00096 zf-C2H2	1.7e-73	250.3	Zinc finger, C2H2 type
5	PF13894 zf-C2H2_4	1.4e-40	145.4	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	0.00022	32.4	C2H2-type zinc finger
7	PF12171 zf-C2H2_jaz	4e-15	66.9	Zinc-finger double-stranded RNA-binding
8	PF13913 zf-C2HC_2	2.2	19.5	zinc-finger of a C2HC-type
9	PF05605 zf-Di19	21	16.8	Drought induced 19 protein (Di19), zinc-binding
10	PF13465 zf-H2C2_2	7.5e-83	280.8	Zinc-finger double domain
11	PF08790 zf-LYAR	62	14.9	LYAR-type C2HC zinc finger
12	PF12874 zf-met	0.33	22.6	Zinc-finger of C2H2 type
13	PF18439 zf_UBZ	0.0003	31.7	Ubiquitin-Binding Zinc Finger
14	PF17032 zinc_ribbon_15	0.009	28.1	zinc-ribbon family
15	PF09723 Zn-ribbon_8	5.2e-09	47.4	Zinc ribbon domain
16	PF17283 Zn_ribbon_SprT	0.069	24.5	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477706

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000304410	0.671	UPF0561 protein C2orf68
2	9606.ENSP00000381220	0.663	HD domain containing 2
3	9606.ENSP00000384369	0.618	Probable methyltransferase-like protein 15
4	9606.ENSP00000360576	0.609	NADPH-dependent diflavin oxidoreductase 1
5	9606.ENSP00000472681	0.586	Achaete-scute homolog 5
6	9606.ENSP00000427120	0.566	Small conductance calcium-activated potassium channel protein 2
7	9606.ENSP00000359050	0.561	UPF0668 protein C10orf76
8	9606.ENSP00000483729	0.532	Microtubule-associated tumor suppressor candidate 2
9	9606.ENSP00000354777	0.516	TANK-binding kinase 1-binding protein 1
10	9606.ENSP00000281154	0.502	ADP/ATP translocase 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.409	transcription regulator activity
GO:0003700	0.378	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010468	0.985	regulation of gene expression
GO:1903506	0.985	regulation of nucleic acid-templated transcription
GO:0006355	0.980	regulation of DNA-templated transcription
GO:0009987	0.492	cellular process
GO:0048523	0.402	negative regulation of cellular process
GO:0045934	0.356	negative regulation of nucleobase-containing compound metabolic process
GO:0008152	0.333	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.976	intracellular non-membrane-bounded organelle
GO:0005737	0.816	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]