StarFunc result for job id A6NFQ2

User Input

>input (919 residues)
MATIAAAAFEALMDGVTCWDVPRGPIPSELLLIGEAAFPVMVNDKGQVLIAASSYGRGRL
VVVSHEGYLSHTGLAPFLLNAVSWLCPCPGAPVGVHPSLAPLVNILQDAGLEAQVKPEPG
EPLGVYCINAYNDTLTATLIQFVKHGGGLLIGGQAWYWASQHGPDKVLSRFPGNKVTSVA
GVYFTDTYGDRDRFKVSKKVPKIPLHVRYGEDVRQDQQQLLEGISELDIRTGGVPSQLLV
HGALAFPLGLDASLNCFLAAAHYGRGRVVLAAHECLLCAPKMGPFLLNAVRWLARGQTGK
VGVNTNLKDLCPLLSEHGLQCSLEPHLNSDLCVYCCKAYSDKEAKQLQEFVAEGGGLLIG
GQAWWWASQNPGHCPLAGFPGNIILNCFGLSILPQTLKAGCFPVPTPEMRSYHFRKALSQ
FQAILNHENGNLEKSCLAKLRVDGAAFLQIPAEGVPAYISLHRLLRKMLRGSGLPAVSRE
NPVASDSYEAAVLSLATGLAHSGTDCSQLAQGLGTWTCSSSLYPSKHPITVEINGINPGN
NDCWVSTGLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKARKLSRAPVVTHQCWMD
RTERSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYYKLGKTSLEEWKRQMQENLAP
WGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQI
SAGWMHSGYPIMCHLESVKEIINEMDMRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCN
LWSVYVHETVLGIPRAQAHEALSPPERERRIKAHLGKGAPLCDWNVWTALETYLQLQEAF
GWEPFTQLFAEYQTLSHLPKDNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSL
ASLPEWQENPMQVYLRARK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NFQ2	1.000	1.000	0.000	919	1.000	1.000	A6NFQ2.pdb.gz	TCAF2_HUMAN TRPM8 channel-associated factor 2 OS=Homo sapiens OX=9606 GN=TCAF2 PE=1 SV=2
2	AFDB:Q6QR59	0.946	0.952	0.000	914	0.579	0.582	Q6QR59.pdb.gz	TCAF3_MOUSE TRPM8 channel-associated factor 3 OS=Mus musculus OX=10090 GN=Tcaf3 PE=1 SV=1
3	AFDB:Q921K8	0.975	0.975	0.000	919	0.748	0.748	Q921K8.pdb.gz	TCAF2_MOUSE TRPM8 channel-associated factor 2 OS=Mus musculus OX=10090 GN=Tcaf2 PE=1 SV=1
4	AFDB:Q9Y4C2	0.904	0.902	0.000	921	0.643	0.642	Q9Y4C2.pdb.gz	TCAF1_HUMAN TRPM8 channel-associated factor 1 OS=Homo sapiens OX=9606 GN=TCAF1 PE=1 SV=3
5	AFDB:Q9I5W4	0.431	0.429	2.693E-23	923	0.146	0.145	Q9I5W4.pdb.gz	IMPA_PSEAE Immunomodulating metalloprotease OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=impA PE=1 SV=1
6	PDB:5kdvA	0.430	0.440	3.158E-23	891	0.147	0.152	5kdvA.pdb.gz	Recognition of protein-linked glycans as a determinant of peptidase activity.
7	PDB:6rqxA	0.175	0.185	7.870E-4	862	0.052	0.056	6rqxA.pdb.gz	Mechanism for antigenic peptide selection by endoplasmic reticulum aminopeptidase 1.
8	PDB:7z8bC	0.084	0.070	2.098E-3	1224	0.071	0.053	7z8bC.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
9	PDB:7cpxA	0.093	0.045	2.816E-3	2262	0.077	0.031	7cpxA.pdb.gz	Structural basis for the biosynthesis of lovastatin.
10	AFDB:Q7KRW4	0.165	0.154	3.383E-3	999	0.053	0.049	Q7KRW4.pdb.gz	Q7KRW4_DROME Aminopeptidase OS=Drosophila melanogaster OX=7227 GN=superdeath PE=1 SV=1
11	AFDB:Q9VTL4	0.140	0.134	4.116E-3	962	0.050	0.048	Q9VTL4.pdb.gz	Q9VTL4_DROME Aminopeptidase N OS=Drosophila melanogaster OX=7227 GN=Dmel\CG6071 PE=3 SV=2
12	AFDB:Q9W2S8	0.173	0.174	5.008E-3	911	0.050	0.050	Q9W2S8.pdb.gz	Q9W2S8_DROME Aminopeptidase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9806 PE=3 SV=1
13	PDB:4wz9B	0.180	0.185	6.805E-3	887	0.048	0.050	4wz9B.pdb.gz	The Anopheles-midgut APN1 structure reveals a new malaria transmission-blocking vaccine epitope.
14	PDB:4tlgA	0.071	0.122	1.167E-2	396	0.050	0.116	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
15	PDB:7lvzD	0.063	0.174	1.167E-2	246	0.032	0.118	7lvzD.pdb.gz	The Crystal Structure of Cysteamine Dioxygenase Reveals the Origin of the Large Substrate Scope of This Vital Mammalian Enzyme.
16	AFDB:Q7Q2T8	0.182	0.166	1.547E-2	1020	0.030	0.027	Q7Q2T8.pdb.gz	AMPN_ANOGA Aminopeptidase N OS=Anopheles gambiae OX=7165 GN=APN1 PE=1 SV=4
17	AFDB:Q10836	0.173	0.158	1.706E-2	1025	0.049	0.044	Q10836.pdb.gz	TRHDE_RAT Thyrotropin-releasing hormone-degrading ectoenzyme OS=Rattus norvegicus OX=10116 GN=Trhde PE=1 SV=1
18	PDB:7nupD	0.172	0.177	1.814E-2	884	0.050	0.052	7nupD.pdb.gz	Endoplasmic reticulum aminopeptidase 2 complexed with a mixed hydroxamic and sulfonyl ligand
19	PDB:5k1vB	0.180	0.192	2.101E-2	849	0.040	0.044	5k1vB.pdb.gz	Crystal Structures of ERAP2 Complexed with Inhibitors Reveal Pharmacophore Requirements for Optimizing Inhibitor Potency.
20	PDB:7chjB	0.073	0.229	2.101E-2	226	0.023	0.093	7chjB.pdb.gz	Molecular basis for cysteine oxidation by plant cysteine oxidases from Arabidopsis thaliana.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GVM2	0.0	1463	712	0.771	0.996	A0A1B0GVM2_HUMAN TRPM8 channel associated factor 2C (Fragment) OS=Homo sapiens OX=9606 GN=TCAF2C PE=4 SV=1
2	A6NFQ2	0.0	1893	919	1.000	1.000	TCAF2_HUMAN TRPM8 channel-associated factor 2 OS=Homo sapiens OX=9606 GN=TCAF2 PE=1 SV=2
3	Q6QR59	0.0	1085	914	0.579	0.582	TCAF3_MOUSE TRPM8 channel-associated factor 3 OS=Mus musculus OX=10090 GN=Tcaf3 PE=1 SV=1
4	Q8N1I1	0.0	1146	564	0.603	0.982	Q8N1I1_HUMAN TRPM8 channel associated factor 2 OS=Homo sapiens OX=9606 GN=TCAF2 PE=1 SV=1
5	Q921K8	0.0	1438	919	0.749	0.749	TCAF2_MOUSE TRPM8 channel-associated factor 2 OS=Mus musculus OX=10090 GN=Tcaf2 PE=1 SV=1
6	Q9Y4C2	0.0	1223	921	0.649	0.647	TCAF1_HUMAN TRPM8 channel-associated factor 1 OS=Homo sapiens OX=9606 GN=TCAF1 PE=1 SV=3
7	A0A8I6B436	0.80	36.2	3840	0.023	0.005	A0A8I6B436_RAT Lysosomal trafficking regulator OS=Rattus norvegicus OX=10116 GN=Lyst PE=1 SV=1
8	A0A0G2K5V4	0.82	36.2	3789	0.023	0.006	A0A0G2K5V4_RAT Lysosomal trafficking regulator OS=Rattus norvegicus OX=10116 GN=Lyst PE=1 SV=2
9	A0A8I5Y701	0.87	36.2	3772	0.023	0.006	A0A8I5Y701_RAT Lysosomal trafficking regulator OS=Rattus norvegicus OX=10116 GN=Lyst PE=1 SV=1
10	Q586I8	3.6	33.5	292	0.018	0.058	Q586I8_TRYB2 Autophagocytosis associated protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=25N14.320 PE=3 SV=1
11	H1AE12	4.7	33.5	742	0.035	0.043	EGCR1_CRYNH Glucosylceramidase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=EGC1 PE=1 SV=1
12	Q9Z2X9	6.7	33.1	3788	0.022	0.005	Q9Z2X9_RAT BEIGE OS=Rattus norvegicus OX=10116 GN=Lyst PE=2 SV=1
13	Q9I594	8.3	32.7	735	0.028	0.035	Q9I594_PSEAE Diguanylate cyclase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA0847 PE=4 SV=1
14	P10634	8.6	32.3	500	0.023	0.042	CP2DQ_RAT Cytochrome P450 2D26 OS=Rattus norvegicus OX=10116 GN=Cyp2d26 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17291 M60-like_N	1.7e-24	97.3	N-terminal domain of M60-like peptidases
2	PF13402 Peptidase_M60	1.2e-79	279.2	Peptidase M60, enhancin and enhancin-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008972231.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008971159.1	0.682	Belongs to the protein-tyrosine phosphatase family. Non- receptor class dual specificity subfamily.
2	9597.XP_008955560.1	0.677	G protein-regulated inducer of neurite outgrowth 2 isoform X1
3	9597.XP_003806827.1	0.673	General transcription factor IIH subunit 2
4	9597.XP_003806253.1	0.650	PDZ domain containing 1
5	9597.XP_008953067.1	0.650	HYDIN, axonemal central pair apparatus protein
6	9597.XP_003809092.1	0.595	Tyrosine-protein phosphatase non-receptor type 20 isoform X1
7	9597.XP_008962191.1	0.564	Protein phosphatase 1 regulatory subunit 14C
8	9597.XP_008955557.1	0.562	NLR family apoptosis inhibitory protein
9	9597.XP_003804406.1	0.535	Belongs to the G-protein coupled receptor 1 family.
10	9597.XP_008963948.1	0.534	Transient receptor potential cation channel subfamily M member 8
11	9597.XP_003820565.1	0.530	Rho guanine nucleotide exchange factor 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044325	1.000	transmembrane transporter binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065009	0.982	regulation of molecular function
GO:0048518	0.972	positive regulation of biological process
GO:0048522	0.962	positive regulation of cellular process
GO:0048523	0.938	negative regulation of cellular process
GO:0051050	0.921	positive regulation of transport
GO:0034762	0.912	regulation of transmembrane transport
GO:0032409	0.911	regulation of transporter activity
GO:0009987	0.908	cellular process
GO:1905475	0.907	regulation of protein localization to membrane
GO:0040012	0.867	regulation of locomotion
GO:1903533	0.843	regulation of protein targeting
GO:1903829	0.821	positive regulation of protein localization
GO:0044092	0.788	negative regulation of molecular function
GO:0043269	0.780	regulation of monoatomic ion transport
GO:0051222	0.778	positive regulation of protein transport
GO:2000145	0.744	regulation of cell motility
GO:0032412	0.727	regulation of monoatomic ion transmembrane transporter activity
GO:0034765	0.718	regulation of monoatomic ion transmembrane transport
GO:0032388	0.712	positive regulation of intracellular transport
GO:1905477	0.710	positive regulation of protein localization to membrane
GO:0090316	0.683	positive regulation of intracellular protein transport
GO:0030334	0.519	regulation of cell migration
GO:0051051	0.478	negative regulation of transport
GO:0034763	0.468	negative regulation of transmembrane transport
GO:0043271	0.464	negative regulation of monoatomic ion transport
GO:0032410	0.464	negative regulation of transporter activity
GO:0032413	0.367	negative regulation of ion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0030054	0.957	cell junction
GO:0005622	0.499	intracellular anatomical structure
GO:0043226	0.479	organelle
GO:0005737	0.455	cytoplasm
GO:0043231	0.454	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]