StarFunc result for job id A6NG13

User Input

>input (374 residues)
MRTKQVNLLITLVAVALFSFSCFSIYRITQTNNQLINCRNHILEFKENMLHLRNKTEKNT
QEMMKVLNRMKYEITKREILSGNLVAQKADILNKNETVSNTFEDLKFFFPHLRKEGRIYP
DVIIGKGKTGVSFALGISTVNRGNYSYLKQTLTSVVSRMTLSQEKDSVVIVLVADSNEDY
LHSVVKMITKKFKRQVRSGSLEVISIPAFLYSSMLNAKHLAEASQKLASWRIKQVLDFCI
LLLYAQPKAKYYLQLEDDIIAKEMYFTKITDFVGNISSNNWFFIEFSMLGFIGKLFRSED
LTHFVRFFLMFYKEKPIDWLLNDIFQVKVCDAGEDLRNCMKRKKQIRIQYKPSLFQHVGI
HSSFPRKEQYEKKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9D4R2	0.717	0.719	1.727E-51	373	0.623	0.625	Q9D4R2.pdb.gz	MGT4D_MOUSE Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like protein MGAT4D OS=Mus musculus OX=10090 GN=Mgat4d PE=1 SV=2
2	AFDB:Q812F8	0.672	0.464	2.175E-33	548	0.356	0.243	Q812F8.pdb.gz	MGT4B_MOUSE Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B OS=Mus musculus OX=10090 GN=Mgat4b PE=2 SV=1
3	AFDB:O77836	0.664	0.469	6.910E-33	535	0.374	0.262	O77836.pdb.gz	MGT4A_BOVIN Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A OS=Bos taurus OX=9913 GN=MGAT4A PE=1 SV=1
4	AFDB:Q9UBM8	0.597	0.471	1.029E-22	478	0.254	0.199	Q9UBM8.pdb.gz	MGT4C_HUMAN Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C OS=Homo sapiens OX=9606 GN=MGAT4C PE=2 SV=2
5	AFDB:Q11068	0.403	0.342	5.426E-7	449	0.128	0.107	Q11068.pdb.gz	MGAT1_CAEEL Putative alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-13 PE=2 SV=2
6	AFDB:P27115	0.336	0.285	1.284E-5	447	0.080	0.067	P27115.pdb.gz	MGAT1_RABIT Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Oryctolagus cuniculus OX=9986 GN=MGAT1 PE=1 SV=1
7	AFDB:O17560	0.387	0.310	1.364E-5	487	0.120	0.092	O17560.pdb.gz	O17560_CAEEL Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-20 PE=1 SV=2
8	AFDB:Q96L58	0.349	0.389	1.541E-5	329	0.072	0.082	Q96L58.pdb.gz	B3GT6_HUMAN Beta-1,3-galactosyltransferase 6 OS=Homo sapiens OX=9606 GN=B3GALT6 PE=1 SV=2
9	AFDB:Q60GL7	0.395	0.330	1.740E-5	458	0.123	0.100	Q60GL7.pdb.gz	Q60GL7_DROME Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Drosophila melanogaster OX=7227 GN=Mgat1 PE=2 SV=1
10	AFDB:G5EFK6	0.423	0.367	1.850E-5	437	0.104	0.089	G5EFK6.pdb.gz	G5EFK6_CAEEL Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=gly-14 PE=2 SV=1
11	PDB:7jhiC	0.293	0.324	2.525E-5	331	0.094	0.106	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
12	PDB:5vcmB	0.356	0.368	1.665E-4	358	0.086	0.089	5vcmB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.
13	PDB:1ll0B	0.301	0.401	2.257E-4	267	0.086	0.120	1ll0B.pdb.gz
14	PDB:5vcsB	0.366	0.414	2.879E-4	323	0.088	0.102	5vcsB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.
15	PDB:6fxrA	0.288	0.167	1.488E-3	700	0.070	0.037	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
16	PDB:5a07A	0.196	0.188	1.582E-3	395	0.091	0.086	5a07A.pdb.gz	Structure of the Glycosyltransferase Ktr4P from Saccharomyces Cerevisiae
17	PDB:4y63A	0.282	0.357	1.898E-3	282	0.075	0.099	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
18	PDB:4decA	0.230	0.286	2.421E-3	284	0.096	0.127	4decA.pdb.gz	Mechanistic insights into the retaining glucosyl-3-phosphoglycerate synthase from mycobacteria.
19	PDB:7d72A	0.294	0.274	2.421E-3	407	0.056	0.052	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
20	PDB:6iwqA	0.243	0.169	3.282E-3	546	0.043	0.029	6iwqA.pdb.gz	Structural basis of carbohydrate transfer activity of UDP-GalNAc: Polypeptide N-acetylgalactosaminyltransferase 7.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9D4R2	1.12e-174	492	373	0.628	0.630	MGT4D_MOUSE Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase-like protein MGAT4D OS=Mus musculus OX=10090 GN=Mgat4d PE=1 SV=2
2	Q812G0	9.60e-84	266	535	0.393	0.275	MGT4A_MOUSE Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A OS=Mus musculus OX=10090 GN=Mgat4a PE=1 SV=1
3	Q9UM21	1.34e-83	266	535	0.404	0.282	MGT4A_HUMAN Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A OS=Homo sapiens OX=9606 GN=MGAT4A PE=1 SV=1
4	O77836	2.40e-82	262	535	0.329	0.230	MGT4A_BOVIN Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A OS=Bos taurus OX=9913 GN=MGAT4A PE=1 SV=1
5	Q9UQ53	1.32e-76	248	548	0.356	0.243	MGT4B_HUMAN Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B OS=Homo sapiens OX=9606 GN=MGAT4B PE=1 SV=1
6	Q812F8	1.67e-76	248	548	0.361	0.246	MGT4B_MOUSE Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B OS=Mus musculus OX=10090 GN=Mgat4b PE=2 SV=1
7	Q9UBM8	7.60e-37	141	478	0.262	0.205	MGT4C_HUMAN Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C OS=Homo sapiens OX=9606 GN=MGAT4C PE=2 SV=2
8	O88494	0.10	36.2	200	0.080	0.150	O88494_MOUSE Type VI collagen alpha 3 subunit N7 domain (Fragment) OS=Mus musculus OX=10090 GN=Col6a3 PE=2 SV=1
9	Q96CW5	0.15	36.6	907	0.037	0.015	GCP3_HUMAN Gamma-tubulin complex component 3 OS=Homo sapiens OX=9606 GN=TUBGCP3 PE=1 SV=2
10	Q9P7X5	1.1	33.9	749	0.040	0.020	PPK32_SCHPO Protein kinase domain-containing protein ppk32 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk32 PE=1 SV=1
11	A0A8I5ZTR6	1.3	33.9	3109	0.075	0.009	A0A8I5ZTR6_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
12	A0A8I6AHL9	1.3	33.9	3316	0.075	0.008	A0A8I6AHL9_RAT Collagen type VI alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col6a3 PE=1 SV=1
13	P53971	3.8	32.3	965	0.056	0.022	FAP1_YEAST FKBP12-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FAP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00535 Glycos_transf_2	66	14.8	Glycosyl transferase family 2
2	PF04666 Glyco_transf_54	8.1e-107	367.8	N-Acetylglucosaminyltransferase-IV (GnT-IV) conserved region
3	PF12072 RNase_Y_N	3.6e+02	12.0	RNase Y N-terminal region
4	PF17083 Swm2	37	15.8	Nucleolar protein Swm2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000421185

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307423	0.953	Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
2	9606.ENSP00000386377	0.944	Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
3	9606.ENSP00000353910	0.923	Alpha-(1,6)-fucosyltransferase
4	9606.ENSP00000391227	0.912	Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B
5	9606.ENSP00000345270	0.910	Beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
6	9606.ENSP00000338487	0.815	Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B
7	9606.ENSP00000264968	0.811	Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A
8	9606.ENSP00000343171	0.706	Uncharacterized protein C2orf80
9	9606.ENSP00000298815	0.635	Rho GTPase-activating protein 42
10	9606.ENSP00000469337	0.623	Leucine-rich repeat-containing protein 63
11	9606.ENSP00000288025	0.603	Transmembrane p24 trafficking protein 6
12	9606.ENSP00000477352	0.595	Short coiled-coil protein
13	9606.ENSP00000404718	0.553	Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
14	9606.ENSP00000296513	0.501	Adenosine deaminase domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0140103	0.999	catalytic activity, acting on a glycoprotein
GO:0008454	0.939	alpha-1,3-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity
GO:0005488	0.919	binding
GO:0005515	0.871	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.915	regulation of biological process
GO:0050794	0.887	regulation of cellular process
GO:0009987	0.855	cellular process
GO:0071704	0.800	organic substance metabolic process
GO:0044238	0.797	primary metabolic process
GO:0044237	0.791	cellular metabolic process
GO:0006807	0.769	nitrogen compound metabolic process
GO:0043170	0.760	macromolecule metabolic process
GO:1901564	0.747	organonitrogen compound metabolic process
GO:0019538	0.741	protein metabolic process
GO:0019222	0.726	regulation of metabolic process
GO:0031323	0.650	regulation of cellular metabolic process
GO:0009100	0.577	glycoprotein metabolic process
GO:0044249	0.553	cellular biosynthetic process
GO:0051246	0.553	regulation of protein metabolic process
GO:1901576	0.547	organic substance biosynthetic process
GO:1901566	0.521	organonitrogen compound biosynthetic process
GO:0036211	0.518	protein modification process
GO:0070085	0.505	glycosylation
GO:0009101	0.501	glycoprotein biosynthetic process
GO:0006486	0.479	protein glycosylation
GO:0051248	0.366	negative regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005794	1.000	Golgi apparatus
GO:0005783	0.947	endoplasmic reticulum
GO:0031090	0.944	organelle membrane
GO:0098588	0.914	bounding membrane of organelle
GO:0000139	0.863	Golgi membrane
GO:0031984	0.832	organelle subcompartment
GO:0098791	0.651	Golgi apparatus subcompartment
GO:0005793	0.625	endoplasmic reticulum-Golgi intermediate compartment
GO:0005795	0.444	Golgi stack
GO:0031982	0.405	vesicle
GO:0070013	0.339	intracellular organelle lumen
GO:0005576	0.326	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:16057	0.939	N(4)-{beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc}-L-asparaginyl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = H(+) + N(4)-{beta-D-GlcNAc-(1->2)-[beta-D-GlcNAc-(1->4)]-alpha-D-Man-(1->3)-[beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-beta-D-GlcNAc}-L-asparaginyl-[protein] + UDP
EC:2.4.1.145	0.939	alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase.

[back to server]