StarFunc result for job id A6NGB9

User Input

>input (483 residues)
MPVPPPPPPPLPPPPPPLGAPPPPPPSAPPVSTDTSSLRRADPKGRSALLADIQQGTRLR
KVTQINDRSAPQIESSKGTNKEGGGSANTRGASTPPTLGDLFAGGFPVLRPAGQRDVAGG
KTGQGPGSRAPSPRLPNKTISGPLIPPASPRLGNTSEAHGAARTAPPRPNVPAPPPPTPP
PPPPPLPPPLPSSSPIKTPLVSPPGPLTKGNLPVVAPPVPCAPPPPPPPPPPTPPPLPPA
SVLSDKAVKPQLAPLHLPPIPPPLPLLPPCGYPGLKAEPASPAQDAQEPPAPPPPLPPYA
SCSPRASLPAPPLPGVNSSSETPPPLPPKSPSFQAPPQKAGAQALPAPPAPPGSQPFLQK
KRHGRPGAGGGKLNPPPAPPARSPTTELSSKSQQATAWTPTQQPGGQLRNGSLHIIDDFE
SKFTFHSVEDFPPPDEYKPCQKIYPSKIPRSRTPGPWLQAEAVGQSSDDIKGRNSQLSLK
TLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NGB9	1.000	1.000	2.094E-64	483	1.000	1.000	A6NGB9.pdb.gz	WIPF3_HUMAN WAS/WASL-interacting protein family member 3 OS=Homo sapiens OX=9606 GN=WIPF3 PE=1 SV=4
2	AFDB:Q9Z0G8	0.138	0.137	1.907E-41	485	0.801	0.798	Q9Z0G8.pdb.gz	WIPF3_RAT WAS/WASL-interacting protein family member 3 OS=Rattus norvegicus OX=10116 GN=Wipf3 PE=1 SV=1
3	AFDB:O43516	0.080	0.077	5.624E-7	503	0.325	0.312	O43516.pdb.gz	WIPF1_HUMAN WAS/WASL-interacting protein family member 1 OS=Homo sapiens OX=9606 GN=WIPF1 PE=1 SV=3
4	AFDB:A0A1D8PI26	0.075	0.060	5.777E-3	664	0.263	0.191	A0A1D8PI26.pdb.gz	A0A1D8PI26_CANAL Vrp1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VRP1 PE=4 SV=1
5	AFDB:Q2KHI9	0.080	0.040	4.731E-1	1134	0.184	0.078	Q2KHI9.pdb.gz	MCM9_MOUSE DNA helicase MCM9 OS=Mus musculus OX=10090 GN=Mcm9 PE=1 SV=2
6	AFDB:Q8SX89	0.070	0.061	6.750E-1	570	0.143	0.121	Q8SX89.pdb.gz	Q8SX89_DROME Kugelkern, isoform A OS=Drosophila melanogaster OX=7227 GN=kuk PE=1 SV=1
7	AFDB:A0A1D8PNH8	0.084	0.045	3.001	1174	0.147	0.060	A0A1D8PNH8.pdb.gz	A0A1D8PNH8_CANAL Chromatin-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD9 PE=4 SV=1
8	AFDB:D3ZB51	0.056	0.028	4.597	1328	0.215	0.078	D3ZB51.pdb.gz	TUTLB_RAT Protein turtle homolog B OS=Rattus norvegicus OX=10116 GN=Igsf9b PE=1 SV=1
9	AFDB:Q8W4K6	0.065	0.055	5.689	602	0.190	0.153	Q8W4K6.pdb.gz	Q8W4K6_ARATH At4g13350 OS=Arabidopsis thaliana OX=3702 GN=NIG PE=1 SV=1
10	AFDB:O75410	0.076	0.052	6.108	805	0.149	0.089	O75410.pdb.gz	TACC1_HUMAN Transforming acidic coiled-coil-containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1 PE=1 SV=2
11	PDB:5xtcm	0.034	0.079	9.240	174	0.014	0.040	5xtcm.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NGB9	0.0	886	483	1.000	1.000	WIPF3_HUMAN WAS/WASL-interacting protein family member 3 OS=Homo sapiens OX=9606 GN=WIPF3 PE=1 SV=4
2	Q9Z0G8	2.90e-147	431	485	0.733	0.730	WIPF3_RAT WAS/WASL-interacting protein family member 3 OS=Rattus norvegicus OX=10116 GN=Wipf3 PE=1 SV=1
3	Q8TF74	1.66e-09	62.0	440	0.106	0.116	WIPF2_HUMAN WAS/WASL-interacting protein family member 2 OS=Homo sapiens OX=9606 GN=WIPF2 PE=1 SV=1
4	O43516	7.14e-04	44.3	503	0.041	0.040	WIPF1_HUMAN WAS/WASL-interacting protein family member 1 OS=Homo sapiens OX=9606 GN=WIPF1 PE=1 SV=3
5	E1JGR7	0.039	38.9	809	0.031	0.019	E1JGR7_DROME Verprolin 1, isoform I OS=Drosophila melanogaster OX=7227 GN=Vrp1 PE=1 SV=1
6	E1JGR9	0.042	38.9	718	0.031	0.021	E1JGR9_DROME Verprolin 1, isoform H OS=Drosophila melanogaster OX=7227 GN=Vrp1 PE=1 SV=1
7	Q8SX98	0.043	38.9	708	0.031	0.021	Q8SX98_DROME GH25793p OS=Drosophila melanogaster OX=7227 GN=Vrp1 PE=1 SV=1
8	Q9P6R1	0.22	36.2	309	0.081	0.126	VRP1_SCHPO Verprolin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vrp1 PE=1 SV=1
9	P37370	5.8	32.0	817	0.046	0.027	VRP1_YEAST Verprolin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VRP1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02205 WH2	4.5e-07	40.7	WH2 motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000242140

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223023	0.996	Neural Wiskott-Aldrich syndrome protein
2	9606.ENSP00000365891	0.970	Wiskott-Aldrich syndrome protein
3	9606.ENSP00000233154	0.944	Cytoplasmic protein NCK2
4	9606.ENSP00000376345	0.938	Growth factor receptor-bound protein 2
5	9606.ENSP00000367220	0.913	Actin-related protein 2
6	9606.ENSP00000483570	0.905	Tyrosine-protein kinase BTK
7	9606.ENSP00000341189	0.903	Focal adhesion kinase 1
8	9606.ENSP00000417273	0.902	Cytoplasmic protein NCK1
9	9606.ENSP00000320924	0.861	WAS/WASL-interacting protein family member 2
10	9606.ENSP00000376330	0.844	WAS/WASL-interacting protein family member 1
11	9606.ENSP00000376368	0.801	Wiskott-Aldrich syndrome protein family member 1
12	9606.ENSP00000294742	0.780	Actin-related protein 2/3 complex subunit 5
13	9606.ENSP00000354251	0.769	Nck-associated protein 1
14	9606.ENSP00000483313	0.768	Wiskott-Aldrich syndrome protein family member 2
15	9606.ENSP00000295685	0.765	Actin-related protein 2/3 complex subunit 2
16	9606.ENSP00000263238	0.763	Actin-related protein 3
17	9606.ENSP00000228825	0.760	Actin-related protein 2/3 complex subunit 3
18	9606.ENSP00000335055	0.739	Wiskott-Aldrich syndrome protein family member 3
19	9606.ENSP00000293373	0.733	Nck-associated protein 1-like
20	9606.ENSP00000432472	0.733	Protein BRICK1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017124	1.000	SH3 domain binding
GO:0008092	0.508	cytoskeletal protein binding
GO:0044877	0.446	protein-containing complex binding
GO:0003779	0.429	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0016043	0.977	cellular component organization
GO:0050794	0.966	regulation of cellular process
GO:0048518	0.842	positive regulation of biological process
GO:0006996	0.825	organelle organization
GO:0048522	0.796	positive regulation of cellular process
GO:0030029	0.602	actin filament-based process
GO:0050896	0.545	response to stimulus
GO:0007010	0.544	cytoskeleton organization
GO:0030036	0.520	actin cytoskeleton organization
GO:0051128	0.476	regulation of cellular component organization
GO:0044087	0.394	regulation of cellular component biogenesis
GO:0051493	0.369	regulation of cytoskeleton organization
GO:0051130	0.342	positive regulation of cellular component organization
GO:1902903	0.327	regulation of supramolecular fiber organization
GO:0032501	0.324	multicellular organismal process
GO:0110053	0.316	regulation of actin filament organization
GO:0032502	0.306	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	0.945	intracellular membrane-bounded organelle
GO:0016020	0.870	membrane
GO:0005634	0.714	nucleus
GO:0043232	0.681	intracellular non-membrane-bounded organelle
GO:0071944	0.490	cell periphery
GO:0070013	0.419	intracellular organelle lumen
GO:0005886	0.302	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]