StarFunc result for job id A6NGE7

User Input

>input (173 residues)
MDIEKVNSMDLGEFVDVFGNATERCPLIAAAVWSQRPFSDLEDLEKHFFAFIDALAQSGQ
EGILRCHPDLAGSELQRGTLTAESQREQSGAGLRSLGADERLRLAELNAQYRARFGFPFV
LAARFSDRTAVPRELARRLLCPSAQELRTALGEVKKIGSLRLADLLRADPAKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q283N4	0.967	0.940	1.038E-21	178	0.780	0.758	Q283N4.pdb.gz	URAD_MOUSE 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase OS=Mus musculus OX=10090 GN=Urad PE=1 SV=1
2	AFDB:A1L259	0.976	0.970	2.178E-18	174	0.520	0.517	A1L259.pdb.gz	URAD_DANRE 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase OS=Danio rerio OX=7955 GN=urad PE=1 SV=1
3	PDB:2o73F	0.961	0.989	9.822E-18	168	0.503	0.518	2o73F.pdb.gz	The structure of 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase provides insights into the mechanism of uric acid degradation.
4	AFDB:Q9LVM5	0.772	0.432	9.741E-6	324	0.214	0.114	Q9LVM5.pdb.gz	TTHL_ARATH Uric acid degradation bifunctional protein TTL OS=Arabidopsis thaliana OX=3702 GN=TTL PE=1 SV=1
5	AFDB:O94659	0.176	0.066	4.975E-1	642	0.133	0.036	O94659.pdb.gz	NOG1_SCHPO Probable nucleolar GTP-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nog1 PE=1 SV=2
6	PDB:6n8jb	0.165	0.065	6.650E-1	647	0.121	0.032	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
7	PDB:6elzb	0.162	0.085	6.996E-1	421	0.145	0.059	6elzb.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
8	PDB:4ariA	0.133	0.059	7.359E-1	821	0.133	0.028	4ariA.pdb.gz	Structural Dynamics of the Aminoacylation and Proofreading Functional Cycle of Bacterial Leucyl-tRNA Synthetase
9	PDB:7ou2B	0.154	0.063	9.974E-1	650	0.133	0.035	7ou2B.pdb.gz	Cryogenic electron microscopy structures reveal how ATP and DNA binding in MutS coordinates sequential steps of DNA mismatch repair.
10	AFDB:Q6Q788	0.174	0.093	1.303	366	0.162	0.077	Q6Q788.pdb.gz	APOA5_HUMAN Apolipoprotein A-V OS=Homo sapiens OX=9606 GN=APOA5 PE=1 SV=1
11	PDB:6ylgb	0.167	0.070	1.352	613	0.127	0.036	6ylgb.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
12	PDB:7d5sB2	0.179	0.054	1.352	851	0.133	0.027	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
13	PDB:3sf5C	0.155	0.128	1.422	230	0.092	0.070	3sf5C.pdb.gz
14	PDB:1huwA	0.179	0.180	1.573	166	0.121	0.127	1huwA.pdb.gz
15	PDB:6yl2B	0.231	0.216	1.655	192	0.139	0.125	6yl2B.pdb.gz	Structural and DNA binding studies of the transcriptional repressor Rv2506 (BkaR) from Mycobacterium tuberculosis supports a role in L-Leucine catabolism
16	AFDB:Q91WN3	0.177	0.079	1.678	478	0.145	0.052	Q91WN3.pdb.gz	S7A13_MOUSE Solute carrier family 7 member 13 OS=Mus musculus OX=10090 GN=Slc7a13 PE=1 SV=1
17	AFDB:Q8IES4	0.156	0.049	1.857	912	0.133	0.025	Q8IES4.pdb.gz	Q8IES4_PLAF7 DNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1304100 PE=3 SV=1
18	AFDB:Q99Q01	0.212	0.092	1.857	565	0.127	0.039	Q99Q01.pdb.gz	OSPD3_SHIFL Effector protease OspD3 OS=Shigella flexneri OX=623 GN=ospD3 PE=1 SV=1
19	AFDB:B3DKN2	0.203	0.092	1.953	537	0.208	0.067	B3DKN2.pdb.gz	B3DKN2_DANRE Nr5a5 protein OS=Danio rerio OX=7955 GN=fd46g06 PE=2 SV=1
20	AFDB:P77335	0.160	0.097	2.055	303	0.121	0.069	P77335.pdb.gz	HLYE_ECOLI Hemolysin E, chromosomal OS=Escherichia coli (strain K12) OX=83333 GN=hlyE PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q283N4	1.86e-93	271	178	0.780	0.758	URAD_MOUSE 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase OS=Mus musculus OX=10090 GN=Urad PE=1 SV=1
2	A1L259	4.57e-60	186	174	0.509	0.506	URAD_DANRE 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase OS=Danio rerio OX=7955 GN=urad PE=1 SV=1
3	Q9LVM5	0.016	37.4	324	0.179	0.096	TTHL_ARATH Uric acid degradation bifunctional protein TTL OS=Arabidopsis thaliana OX=3702 GN=TTL PE=1 SV=1
4	Q1L9A0	2.2	31.2	687	0.087	0.022	Q1L9A0_DANRE RAS guanyl-releasing protein 1 OS=Danio rerio OX=7955 GN=si:dkey-12o15.1 PE=2 SV=1
5	Q9W2F3	5.4	30.0	1377	0.098	0.012	Q9W2F3_DROME Protein tyrosine phosphatase ERK OS=Drosophila melanogaster OX=7227 GN=PTP-ER PE=2 SV=2
6	P37303	8.3	29.3	387	0.081	0.036	GLY1_YEAST Low specificity L-threonine aldolase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLY1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09349 OHCU_decarbox	9.9e-34	128.6	OHCU decarboxylase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333490

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368727	0.698	Xanthine dehydrogenase/oxidase
2	9606.ENSP00000304331	0.642	GS homeobox 1
3	9606.ENSP00000362613	0.616	Homeobox protein CDX-4
4	9606.ENSP00000370414	0.593	ATP synthase subunit epsilon-like protein, mitochondrial
5	9606.ENSP00000256151	0.524	Thyroid transcription factor 1-associated protein 26
6	9606.ENSP00000370408	0.500	Homeobox protein CDX-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051997	1.000	2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase activity
GO:0005488	0.445	binding
GO:0005515	0.433	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.991	organic substance metabolic process
GO:0009987	0.986	cellular process
GO:0044238	0.982	primary metabolic process
GO:0044281	0.963	small molecule metabolic process
GO:0006139	0.953	nucleobase-containing compound metabolic process
GO:0044282	0.948	small molecule catabolic process
GO:0006796	0.948	phosphate-containing compound metabolic process
GO:1901575	0.947	organic substance catabolic process
GO:0072521	0.940	purine-containing compound metabolic process
GO:0009117	0.940	nucleotide metabolic process
GO:1901657	0.915	glycosyl compound metabolic process
GO:1901136	0.915	carbohydrate derivative catabolic process
GO:0072523	0.915	purine-containing compound catabolic process
GO:0009150	0.915	purine ribonucleotide metabolic process
GO:0009116	0.914	nucleoside metabolic process
GO:0009123	0.914	nucleoside monophosphate metabolic process
GO:0009166	0.914	nucleotide catabolic process
GO:1901658	0.877	glycosyl compound catabolic process
GO:0006195	0.877	purine nucleotide catabolic process
GO:0009167	0.875	purine ribonucleoside monophosphate metabolic process
GO:0034656	0.875	nucleobase-containing small molecule catabolic process
GO:0009112	0.862	nucleobase metabolic process
GO:0042454	0.862	ribonucleoside catabolic process
GO:0009261	0.839	ribonucleotide catabolic process
GO:0019692	0.836	deoxyribose phosphate metabolic process
GO:0009262	0.836	deoxyribonucleotide metabolic process
GO:0046040	0.788	IMP metabolic process
GO:0009394	0.749	2'-deoxyribonucleotide metabolic process
GO:0065007	0.736	biological regulation
GO:0009162	0.718	deoxyribonucleoside monophosphate metabolic process
GO:0006144	0.703	purine nucleobase metabolic process
GO:0009154	0.703	purine ribonucleotide catabolic process
GO:0050789	0.652	regulation of biological process
GO:0046113	0.482	nucleobase catabolic process
GO:0050794	0.421	regulation of cellular process
GO:0042278	0.420	purine nucleoside metabolic process
GO:0046033	0.420	AMP metabolic process
GO:0046128	0.408	purine ribonucleoside metabolic process
GO:0043603	0.383	amide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005777	0.997	peroxisome
GO:0005829	0.897	cytosol
GO:0016020	0.767	membrane
GO:0070013	0.739	intracellular organelle lumen
GO:0031981	0.549	nuclear lumen
GO:0005654	0.305	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:26301	1.000	5-hydroxy-2-oxo-4-ureido-2,5-dihydro-1H-imidazole-5-carboxylate + H(+) = (S)-allantoin + CO2

[back to server]