StarFunc result for job id A6NGG8

User Input

>input (1288 residues)
MGCTPSHSDLVNSVAKSGIQFLKKPKAIRPGCQGGSERGSIPLLVKNSTCYDAGEGLAEE
QPSPRRNQTTAKGLCQLMGDPASGKRKDMEGLIPGTKTSSSQLNKSQSHMAKDIPFKTQG
SHGSQGADFSGDESEESSTQDTSKWKRTAKCHTSSTQSHCYQTIHPAHEPEGKVDFPEPL
VKAHQQAYTYLHSSLSKYEAILCIIHQATQTRELLQPMVSFLLLCFEEISQLLGEISKDG
EVLLQEVREDLAWPLKKREPQEQPNLLQQLLQYTVSKLQVLNGTVASLTGSFLEGSSSYL
HSTATHLENKLSTKRNVDERLLRALRQLESLASGCGDPGVQGLPLCSEDSGIGADNESVQ
SVDKLGKQTSWDLAPEPEEWKSVTSPHTEARQSGHTWQQSPFCLGSGRPQDCLLSGAPMA
KVQPRAQDEARSPCLSSTSPENITSPPLKLGTSTPCDSFGIGVSVEPHLSKTSRPMDASS
LSDSEDSSPEEEEEDKMSSMSLCAWQEKTPHSRPQSSPADRESPFQARTRRLRSLQAQEM
ILKMKESISERIKFVPVPCGHQDWSEEEEGRTVVPPRPSTVSGSRRAPERQTRSQSESCL
QSHVEDPTFQELRRVQRDLSQKLEAFYALGAKGQGQSQEQILQPRAAAVWPNGTCRVSPS
NTTSRLKASLTKNFSILPSQDKSILQKCNPHPEDEQGKAGKLPNAIPSGEVSEAAKATDW
NVRGCPTRTSVKKLIETFSPTESLRMLGDSKDAGASPCLRNCIMPPRFPKYTGLAPLYPK
PQISPASGRESLKMGIGWKPLAPIFPPLPKAEAAKSEELSCEMEGNLEHLPPPPMEVLMD
KSFASLESPESSKSTENSPKETQEPGPGEAGPTRRTWASPKLRASVSPLDLLPSKSTASL
TKPHSTGPGSGRSSCQPRKPALDLSSPPATSQSPEVKGGTWSQAEKATSLYRQPRKAIAW
HHSGPPSGQNRTSESSLARPRQSRERSPPVGRKASPTRTHWVPQADKRRRSLPSSYRPAQ
PSPSAVQTPPSPPVSPRVLSPPTTKRRTSPPHQPKLPNPPPESAPAQCKVPSPPTQHPEA
SPPFSIPSPSPPMSPSQEHKETRDSEDSQAVIAKVSGNTHSIFCPATSSLFEAKPPLSTA
HPLTPPSLPPEAGGPLGNPAECWKNSSGPWLRADSQRRAALCALNPLPFLRRTASDRQPG
GRPQPPTLDPTSTSYESQLGQNSSSEESPKKDTEPGSSPCSPELQGGTRRASPPEFCVLG
HGLQPEPRTGHIQDKSQPEAQPQQEEVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NGG8	0.999	0.999	0.000	1288	1.000	1.000	A6NGG8.pdb.gz	PCARE_HUMAN Photoreceptor cilium actin regulator OS=Homo sapiens OX=9606 GN=PCARE PE=1 SV=1
2	AFDB:Q6PAC4	0.180	0.181	6.686E-103	1279	0.582	0.586	Q6PAC4.pdb.gz	PCARE_MOUSE Photoreceptor cilium actin regulator OS=Mus musculus OX=10090 GN=Pcare PE=2 SV=1
3	AFDB:Q9W1X4	0.029	0.024	1.370E-8	1711	0.161	0.122	Q9W1X4.pdb.gz	NU214_DROME Nuclear pore complex protein Nup214 OS=Drosophila melanogaster OX=7227 GN=Nup214 PE=1 SV=2
4	AFDB:Q9NZ56	0.043	0.035	1.701E-8	1722	0.172	0.129	Q9NZ56.pdb.gz	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
5	AFDB:Q8INR6	0.047	0.035	2.820E-8	1848	0.152	0.106	Q8INR6.pdb.gz	DOT1L_DROME Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Drosophila melanogaster OX=7227 GN=gpp PE=1 SV=2
6	AFDB:F4J7T2	0.046	0.032	5.063E-7	1907	0.172	0.116	F4J7T2.pdb.gz	EAF1B_ARATH Chromatin modification-related protein EAF1 B OS=Arabidopsis thaliana OX=3702 GN=EAF1B PE=1 SV=1
7	AFDB:Q8TEK3	0.049	0.044	9.697E-7	1537	0.154	0.129	Q8TEK3.pdb.gz	DOT1L_HUMAN Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Homo sapiens OX=9606 GN=DOT1L PE=1 SV=3
8	AFDB:Q70IV5	0.052	0.044	1.042E-6	1561	0.145	0.120	Q70IV5.pdb.gz	SYNEM_MOUSE Synemin OS=Mus musculus OX=10090 GN=Synm PE=1 SV=2
9	AFDB:P35658	0.055	0.037	1.120E-6	2090	0.182	0.112	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
10	AFDB:F1QXN5	0.055	0.051	3.309E-6	1416	0.097	0.088	F1QXN5.pdb.gz
11	PDB:7wtxt	0.021	0.141	2.786	132	0.012	0.114	7wtxt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
12	PDB:6yufC	0.064	0.129	4.619	456	0.021	0.059	6yufC.pdb.gz	A Structure-Based Mechanism for DNA Entry into the Cohesin Ring.
13	PDB:7dvqR	0.020	0.072	6.165	241	0.021	0.112	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:4n78F	0.066	0.375	7.123	156	0.012	0.096	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
15	PDB:7qp6y	0.027	0.044	8.845	697	0.018	0.033	7qp6y.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NGG8	0.0	2590	1288	1.000	1.000	PCARE_HUMAN Photoreceptor cilium actin regulator OS=Homo sapiens OX=9606 GN=PCARE PE=1 SV=1
2	Q6PAC4	0.0	1212	1279	0.586	0.590	PCARE_MOUSE Photoreceptor cilium actin regulator OS=Mus musculus OX=10090 GN=Pcare PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15449 Retinal	0	2127.7	Retinal protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332809

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000424243	0.710	Protein eyes shut homolog
2	9606.ENSP00000480489	0.694	PDZ domain-containing protein 7
3	9606.ENSP00000385158	0.693	Protein FAM161A
4	9606.ENSP00000193391	0.686	Interphotoreceptor matrix proteoglycan 2
5	9606.ENSP00000465932	0.682	Progressive rod-cone degeneration protein
6	9606.ENSP00000371923	0.679	Retinitis pigmentosa 1-like 1 protein
7	9606.ENSP00000305941	0.669	Usherin
8	9606.ENSP00000329158	0.656	Clarin-1
9	9606.ENSP00000318373	0.654	Zinc finger protein 513
10	9606.ENSP00000229771	0.653	Tubby-related protein 1
11	9606.ENSP00000482306	0.640	Tetratricopeptide repeat protein 8
12	9606.ENSP00000380661	0.635	Centrosome-associated protein CEP250
13	9606.ENSP00000341159	0.633	Ceramide kinase-like protein
14	9606.ENSP00000255266	0.631	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha
15	9606.ENSP00000286688	0.613	Protein C8orf37
16	9606.ENSP00000359245	0.612	Retinal-specific ATP-binding cassette transporter
17	9606.ENSP00000449079	0.612	Retinol dehydrogenase 12
18	9606.ENSP00000251102	0.609	Cyclic nucleotide-gated cation channel beta-1
19	9606.ENSP00000420295	0.608	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta
20	9606.ENSP00000356370	0.604	Protein crumbs homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.992	multicellular organismal process
GO:0009987	0.983	cellular process
GO:0071840	0.788	cellular component organization or biogenesis
GO:0032502	0.782	developmental process
GO:0016043	0.781	cellular component organization
GO:0048856	0.761	anatomical structure development
GO:0051179	0.752	localization
GO:0007275	0.663	multicellular organism development
GO:0007399	0.652	nervous system development
GO:0046530	0.617	photoreceptor cell differentiation
GO:0042461	0.448	photoreceptor cell development
GO:0065007	0.366	biological regulation
GO:0050789	0.364	regulation of biological process
GO:0033036	0.353	macromolecule localization
GO:0050794	0.339	regulation of cellular process
GO:0008104	0.332	protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	0.998	cilium
GO:0005622	0.977	intracellular anatomical structure
GO:0043229	0.959	intracellular organelle
GO:0016020	0.841	membrane
GO:0005737	0.806	cytoplasm
GO:0043005	0.767	neuron projection
GO:0071944	0.757	cell periphery
GO:0043228	0.695	non-membrane-bounded organelle
GO:0043232	0.654	intracellular non-membrane-bounded organelle
GO:0097730	0.636	non-motile cilium
GO:0005856	0.632	cytoskeleton
GO:0097733	0.621	photoreceptor cell cilium
GO:0015630	0.577	microtubule cytoskeleton
GO:0043231	0.538	intracellular membrane-bounded organelle
GO:0070013	0.479	intracellular organelle lumen
GO:0001750	0.468	photoreceptor outer segment
GO:0031981	0.426	nuclear lumen
GO:0005654	0.399	nucleoplasm
GO:0099512	0.388	supramolecular fiber
GO:0005874	0.377	microtubule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]