StarFunc result for job id A6NGH8

User Input

>input (418 residues)
MGNITRKGSRDLVVDSAKSLEDGPSAALHSKLYEAIMREDCTTIEVLLRNHPVNQPITIL
PNSASNRLLLTQPTESIIPIHLAAKYHKAQSLLCLLRHGADPEVRDTTGLTTLNLMLLHW
PVTSTTWAKPGNRTHRILTDIQNSSITCLRILCAHGAQVNTQGEISNKRSPLHLAIAYGC
YPVLSILTQNGADVNAINEASMTPLHMAANMLNKEMMETLIAYGANVNCAVSSTGNTPLK
LAVCTASSKAGRLLGAGVSCIRLLLTHGAKVNAQDYKGQTAIHEACFGGREAIINLLLEF
EANVNILTRNGESPIYMYLQRSCNVRDTALLARLLYHTYPLRMTNNQGILPAGIMLPEFR
LLRDTLIKQSQKPLSLQGICKRNIRNIYGEKYKQHLKQFLPVTIWNSVYCCYDLAYTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NGH8	1.000	1.000	5.000E-58	418	1.000	1.000	A6NGH8.pdb.gz	ANR61_HUMAN Ankyrin repeat domain-containing protein 61 OS=Homo sapiens OX=9606 GN=ANKRD61 PE=4 SV=2
2	AFDB:Q8WXI3	0.534	0.485	8.280E-14	467	0.237	0.212	Q8WXI3.pdb.gz	ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens OX=9606 GN=ASB10 PE=1 SV=2
3	AFDB:Q6ZVZ8	0.519	0.472	9.585E-13	466	0.220	0.197	Q6ZVZ8.pdb.gz	ASB18_HUMAN Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens OX=9606 GN=ASB18 PE=2 SV=2
4	AFDB:Q96NS5	0.538	0.503	3.064E-12	453	0.213	0.196	Q96NS5.pdb.gz	ASB16_HUMAN Ankyrin repeat and SOCS box protein 16 OS=Homo sapiens OX=9606 GN=ASB16 PE=1 SV=2
5	AFDB:Q9WV71	0.585	0.576	3.064E-12	426	0.203	0.200	Q9WV71.pdb.gz	ASB4_MOUSE Ankyrin repeat and SOCS box protein 4 OS=Mus musculus OX=10090 GN=Asb4 PE=1 SV=1
6	AFDB:O15084	0.529	0.231	9.016E-12	1053	0.187	0.074	O15084.pdb.gz	ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5
7	AFDB:Q80YE7	0.525	0.177	9.796E-12	1442	0.194	0.056	Q80YE7.pdb.gz	DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Dapk1 PE=1 SV=3
8	AFDB:O95271	0.367	0.152	1.365E-11	1327	0.232	0.073	O95271.pdb.gz	TNKS1_HUMAN Poly [ADP-ribose] polymerase tankyrase-1 OS=Homo sapiens OX=9606 GN=TNKS PE=1 SV=2
9	AFDB:Q9ERK0	0.449	0.248	1.752E-11	786	0.230	0.122	Q9ERK0.pdb.gz	RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Ripk4 PE=1 SV=2
10	AFDB:Q3KN55	0.409	0.274	1.826E-11	697	0.203	0.122	Q3KN55.pdb.gz	Q3KN55_DROME Ankyrin 2, isoform E OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
11	PDB:8cs9A	0.511	0.293	9.841E-11	796	0.199	0.104	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:4oauC	0.518	0.335	2.458E-8	692	0.172	0.104	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
13	PDB:5vkqA	0.464	0.156	3.025E-8	1499	0.177	0.049	5vkqA.pdb.gz
14	PDB:6v9hC	0.433	0.644	1.051E-7	270	0.182	0.281	6v9hC.pdb.gz
15	PDB:2dvwA	0.441	0.764	1.958E-7	229	0.139	0.253	2dvwA.pdb.gz
16	PDB:1wg0A	0.406	0.650	4.404E-6	243	0.136	0.235	1wg0A.pdb.gz
17	PDB:6aunA	0.480	0.338	5.889E-6	618	0.144	0.097	6aunA.pdb.gz
18	PDB:6mwqA	0.311	0.266	2.624E-5	493	0.139	0.118	6mwqA.pdb.gz
19	PDB:6jd6B	0.351	0.733	2.972E-5	192	0.122	0.266	6jd6B.pdb.gz
20	PDB:1bd8A	0.278	0.648	8.390E-5	156	0.089	0.237	1bd8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NGH8	0.0	862	418	1.000	1.000	ANR61_HUMAN Ankyrin repeat domain-containing protein 61 OS=Homo sapiens OX=9606 GN=ANKRD61 PE=4 SV=2
2	X2JCM1	8.40e-20	94.7	11634	0.179	0.006	X2JCM1_DROME Ankyrin 2, isoform AA OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
3	M9MRX4	8.43e-20	94.7	13559	0.179	0.006	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
4	Q12955	8.79e-20	94.7	4377	0.191	0.018	ANK3_HUMAN Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3
5	M9MSK6	1.49e-19	94.0	4352	0.179	0.017	M9MSK6_DROME Ankyrin 2, isoform Q OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
6	M9MRX1	1.50e-19	94.0	4329	0.179	0.017	M9MRX1_DROME Ankyrin 2, isoform S OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
7	G5E8K5	1.52e-19	94.0	1961	0.194	0.041	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
8	A8JNM6	1.59e-19	94.0	4189	0.179	0.018	A8JNM6_DROME Ankyrin 2, isoform J OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
9	A8JNM7	1.59e-19	94.0	4114	0.179	0.018	A8JNM7_DROME Ankyrin 2, isoform F OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
10	M9MRR4	1.59e-19	94.0	4223	0.179	0.018	M9MRR4_DROME Ankyrin 2, isoform T OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
11	M9MS19	1.59e-19	94.0	4230	0.179	0.018	M9MS19_DROME Ankyrin 2, isoform P OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
12	Q7KU92	1.74e-19	93.6	4083	0.179	0.018	Q7KU92_DROME Ankyrin 2, isoform L OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=2
13	M9MRS5	1.92e-19	93.6	4496	0.179	0.017	M9MRS5_DROME Ankyrin 2, isoform R OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
14	A8JNM5	1.93e-19	93.6	4264	0.179	0.018	A8JNM5_DROME Ankyrin 2, isoform K OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
15	M9PEN3	1.93e-19	93.6	4373	0.179	0.017	M9PEN3_DROME Ankyrin 2, isoform V OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
16	X2JC49	2.00e-19	93.6	4233	0.179	0.018	X2JC49_DROME Ankyrin 2, isoform Z OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
17	A8JNM4	4.21e-19	92.4	2532	0.179	0.030	A8JNM4_DROME Ankyrin 2, isoform G OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
18	X2JGD3	4.41e-19	92.4	2566	0.179	0.029	X2JGD3_DROME Ankyrin 2, isoform Y OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
19	Q7KU95	5.38e-19	92.0	2404	0.179	0.031	Q7KU95_DROME Ankyrin 2, isoform M OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	A0A5F9ZI40	8.59e-19	91.7	3915	0.196	0.021	A0A5F9ZI40_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	4.6e-20	82.3	Ankyrin repeat
2	PF12796 Ank_2	6.7e-20	82.8	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	6.4e-18	73.8	Ankyrin repeat
4	PF13637 Ank_4	3.5e-18	77.0	Ankyrin repeats (many copies)
5	PF13857 Ank_5	9e-21	84.9	Ankyrin repeats (many copies)
6	PF00206 Lyase_1	3.9e+02	11.8	Lyase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386502

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384766	0.867	Radial spoke head 10 homolog B2
2	9606.ENSP00000385443	0.825	Radial spoke head 10 homolog B
3	9606.ENSP00000223029	0.665	Aminoacyl tRNA synthase complex-interacting multifunctional protein 2
4	9606.ENSP00000301962	0.561	Ubiquitin carboxyl-terminal hydrolase 42
5	9606.ENSP00000297044	0.534	Cytohesin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.742	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.899	organic substance metabolic process
GO:0044238	0.898	primary metabolic process
GO:0006807	0.879	nitrogen compound metabolic process
GO:0043170	0.852	macromolecule metabolic process
GO:0065007	0.653	biological regulation
GO:0019538	0.463	protein metabolic process
GO:0050789	0.402	regulation of biological process
GO:0070647	0.392	protein modification by small protein conjugation or removal
GO:0050794	0.383	regulation of cellular process
GO:0009987	0.348	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005829	0.949	cytosol
GO:0032991	0.654	protein-containing complex
GO:0016020	0.425	membrane
GO:0140535	0.354	intracellular protein-containing complex
GO:1902494	0.305	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]