StarFunc result for job id A6NGQ2

User Input

>input (149 residues)
MVDDAGAAESQRGKQTPAHSLEQLRRLPLPPPQIRIRPWWFPVQELRDPLVFYLEAWLAD
ELFGPDRAIIPEMEWTSQALLTVDIVDSGNLVEITVFGRPRVQNRVKSMLLCLAWFHREH
RARAEKMKHLEKNLKAHASDPHSPQDPVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NGQ2	1.000	1.000	7.311E-28	149	1.000	1.000	A6NGQ2.pdb.gz	OOEP_HUMAN Oocyte-expressed protein homolog OS=Homo sapiens OX=9606 GN=OOEP PE=1 SV=3
2	AFDB:Q9CWE6	0.660	0.603	5.365E-13	164	0.443	0.402	Q9CWE6.pdb.gz	OOEP_MOUSE Oocyte-expressed protein homolog OS=Mus musculus OX=10090 GN=Ooep PE=1 SV=1
3	AFDB:Q9CQS7	0.573	0.703	2.774E-8	118	0.201	0.254	Q9CQS7.pdb.gz	DPA5A_MOUSE Developmental pluripotency-associated protein 5A OS=Mus musculus OX=10090 GN=Dppa5a PE=1 SV=2
4	AFDB:Q587J8	0.641	0.445	4.348E-8	217	0.221	0.152	Q587J8.pdb.gz	KHDC3_HUMAN KH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=KHDC3L PE=1 SV=1
5	AFDB:Q9CWU5	0.579	0.223	1.501E-5	440	0.242	0.082	Q9CWU5.pdb.gz	KHDC3_MOUSE KH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Khdc3 PE=1 SV=1
6	AFDB:Q3UWR2	0.448	0.405	9.664E-5	166	0.188	0.169	Q3UWR2.pdb.gz	KHD1A_MOUSE KH homology domain-containing protein 1A OS=Mus musculus OX=10090 GN=Khdc1a PE=2 SV=1
7	AFDB:D3YX29	0.497	0.613	1.722E-4	119	0.128	0.160	D3YX29.pdb.gz	D3YX29_MOUSE Oocyte maturation, beta OS=Mus musculus OX=10090 GN=Omt2b PE=4 SV=1
8	AFDB:Q86TM3	0.404	0.101	1.722E-4	631	0.141	0.033	Q86TM3.pdb.gz	DDX53_HUMAN Probable ATP-dependent RNA helicase DDX53 OS=Homo sapiens OX=9606 GN=DDX53 PE=1 SV=3
9	AFDB:Q9NXZ2	0.391	0.095	1.959E-4	648	0.174	0.040	Q9NXZ2.pdb.gz	DDX43_HUMAN Probable ATP-dependent RNA helicase DDX43 OS=Homo sapiens OX=9606 GN=DDX43 PE=1 SV=2
10	AFDB:Q7KHL0	0.494	0.166	2.879E-4	508	0.161	0.047	Q7KHL0.pdb.gz	Q7KHL0_DROME Bancal protein OS=Drosophila melanogaster OX=7227 GN=HnRNP-K PE=2 SV=1
11	PDB:7ajuJJ	0.331	0.260	1.858E-1	199	0.087	0.065	7ajuJJ.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
12	PDB:6w17D	0.247	0.142	4.015E-1	301	0.128	0.063	6w17D.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.
13	PDB:4v6wCX	0.231	0.270	5.192E-1	120	0.087	0.108	4v6wCX.pdb.gz	Structures of the human and Drosophila 80S ribosome.
14	PDB:7dl8A	0.166	0.217	5.903E-1	114	0.114	0.149	7dl8A.pdb.gz
15	PDB:5o5eA	0.185	0.090	7.157E-1	381	0.081	0.031	5o5eA.pdb.gz	Structures of DPAGT1 Explain Glycosylation Disease Mechanisms and Advance TB Antibiotic Design.
16	PDB:8bc0B	0.221	0.064	7.157E-1	636	0.060	0.014	8bc0B.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
17	PDB:6ke6RC	0.311	0.181	7.632E-1	278	0.107	0.058	6ke6RC.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
18	PDB:7vbaK	0.244	0.310	7.632E-1	108	0.054	0.074	7vbaK.pdb.gz	Structure of the human RNA polymerase I elongation complex.
19	PDB:8b8kA	0.221	0.057	8.138E-1	741	0.054	0.011	8b8kA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
20	PDB:7odrg	0.252	0.273	9.254E-1	134	0.074	0.082	7odrg.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NGQ2	8.30e-108	305	149	1.000	1.000	OOEP_HUMAN Oocyte-expressed protein homolog OS=Homo sapiens OX=9606 GN=OOEP PE=1 SV=3
2	Q9CWE6	1.32e-37	127	164	0.396	0.360	OOEP_MOUSE Oocyte-expressed protein homolog OS=Mus musculus OX=10090 GN=Ooep PE=1 SV=1
3	F6SZT2	5.15e-15	70.9	206	0.235	0.170	KHDC3_MACMU KH domain-containing protein 3 OS=Macaca mulatta OX=9544 GN=KHDC3L PE=2 SV=2
4	Q587J8	5.02e-13	65.9	217	0.221	0.152	KHDC3_HUMAN KH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=KHDC3L PE=1 SV=1
5	Q9CQS7	3.36e-06	45.8	118	0.201	0.254	DPA5A_MOUSE Developmental pluripotency-associated protein 5A OS=Mus musculus OX=10090 GN=Dppa5a PE=1 SV=2
6	Q9CWU5	6.53e-06	46.6	440	0.195	0.066	KHDC3_MOUSE KH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Khdc3 PE=1 SV=1
7	P0C7A0	0.73	31.2	126	0.141	0.167	KHD1B_MOUSE KH homology domain-containing protein 1B OS=Mus musculus OX=10090 GN=Khdc1b PE=2 SV=1
8	Q9EPQ1	3.8	30.0	795	0.094	0.018	TLR1_MOUSE Toll-like receptor 1 OS=Mus musculus OX=10090 GN=Tlr1 PE=1 SV=1
9	Q9EPW9	4.2	29.6	795	0.094	0.018	TLR6_MOUSE Toll-like receptor 6 OS=Mus musculus OX=10090 GN=Tlr6 PE=1 SV=2
10	P40559	7.6	28.9	946	0.114	0.018	INP51_YEAST Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP51 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=INP51 PE=1 SV=1
11	Q6P690	7.6	28.9	806	0.081	0.015	Q6P690_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=2 SV=1
12	A0A096MKA9	7.7	28.9	806	0.081	0.015	A0A096MKA9_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=3 SV=2
13	G3V695	8.3	28.9	811	0.081	0.015	G3V695_RAT Toll-like receptor OS=Rattus norvegicus OX=10116 GN=Tlr6 PE=3 SV=2
14	E9PTL5	8.8	28.9	808	0.081	0.015	E9PTL5_RAT Toll-like receptor 1 OS=Rattus norvegicus OX=10116 GN=Tlr1 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20352 DUF6647	32	15.7	Family of unknown function (DUF6647)
2	PF16005 MOEP19	1.6e-35	132.3	KH-like RNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359384

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246112	0.975	Transducin-like enhancer protein 6
2	9606.ENSP00000359411	0.920	KH homology domain-containing protein 1
3	9606.ENSP00000375063	0.889	NACHT, LRR and PYD domains-containing protein 5
4	9606.ENSP00000483125	0.823	Protein-arginine deiminase type-6
5	9606.ENSP00000411124	0.718	Brain-enriched guanylate kinase-associated protein
6	9606.ENSP00000398930	0.611	Epsilon-sarcoglycan
7	9606.ENSP00000435342	0.595	Retrotransposon-like protein 1
8	9606.ENSP00000467123	0.578	NACHT, LRR and PYD domains-containing protein 7
9	9606.ENSP00000329803	0.561	Zygote arrest protein 1
10	9606.ENSP00000319231	0.560	Pleckstrin homology-like domain family A member 2
11	9606.ENSP00000444503	0.559	Homeobox protein SEBOX
12	9606.ENSP00000338034	0.558	SPRY domain containing 4
13	9606.ENSP00000359361	0.546	Probable ATP-dependent RNA helicase DDX43
14	9606.ENSP00000356574	0.538	Sulfhydryl oxidase 1
15	9606.ENSP00000381895	0.530	Single-pass membrane protein with coiled-coil domains 3
16	9606.ENSP00000445135	0.514	NACHT, LRR and PYD domains-containing protein 2
17	9606.ENSP00000387007	0.506	Condensin-2 complex subunit G2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.559	organic cyclic compound binding
GO:1901363	0.547	heterocyclic compound binding
GO:0003676	0.385	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0080090	0.985	regulation of primary metabolic process
GO:0048583	0.973	regulation of response to stimulus
GO:0009987	0.969	cellular process
GO:0051171	0.960	regulation of nitrogen compound metabolic process
GO:0048522	0.951	positive regulation of cellular process
GO:0060255	0.948	regulation of macromolecule metabolic process
GO:0009893	0.919	positive regulation of metabolic process
GO:0031323	0.874	regulation of cellular metabolic process
GO:0010604	0.787	positive regulation of macromolecule metabolic process
GO:0019219	0.653	regulation of nucleobase-containing compound metabolic process
GO:0080134	0.602	regulation of response to stress
GO:0080135	0.444	regulation of cellular response to stress
GO:2001020	0.426	regulation of response to DNA damage stimulus
GO:0051173	0.400	positive regulation of nitrogen compound metabolic process
GO:0008152	0.369	metabolic process
GO:0048584	0.351	positive regulation of response to stimulus
GO:0071704	0.349	organic substance metabolic process
GO:0044238	0.342	primary metabolic process
GO:2000779	0.336	regulation of double-strand break repair
GO:0031325	0.332	positive regulation of cellular metabolic process
GO:0071840	0.325	cellular component organization or biogenesis
GO:0006807	0.322	nitrogen compound metabolic process
GO:0050896	0.316	response to stimulus
GO:0044237	0.315	cellular metabolic process
GO:0045935	0.303	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0106333	0.723	subcortical maternal complex
GO:0071944	0.642	cell periphery
GO:0070013	0.591	intracellular organelle lumen
GO:0031981	0.569	nuclear lumen
GO:0005654	0.351	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]