StarFunc result for job id A6NGW2

User Input

>input (1772 residues)
MALSLWPLLLLLLLLLLLSFAVTLAPTGPHSLDPGLSFLKSLLSTLDQAPQGSLSRSRFF
TFLANISSSFEPGRMGEGPVGEPPPLQPPALRLHDFLVTLRGSPDWEPMLGLLGDMLALL
GQEQTPRDFLVHQAGVLGGLVEVLLGALVPGGPPTPTQPPCTRDGPSDCVLAADWLPSLL
LLLEGTRWQALVQVQPSVDPTNATGLDGREAAPHFLQGLLGLLTPTGELGSKEALWGGLL
RTVGAPLYAAFQEGLLRVTHSLQDEVFSILGQPEPDTNGQCQGGNLQQLLLWGVRHNLSW
DVQALGFLSGSPPPPPALLHCLSTGVPLPRASQPSAHISPRQRRAITVEALCENHLGPAP
PYSISNFSIHLLCQHTKPATPQPHPSTTAICQTAVWYAVSWAPGAQGWLQACHDQFPDEF
LDAICSNLSFSALSGSNRRLVKRLCAGLLPPPTSCPEGLPPVPLTPDIFWGCFLENETLW
AERLCGEASLQAVPPSNQAWVQHVCQGPTPDVTASPPCHIGPCGERCPDGGSFLVMVCAN
DTMYEVLVPFWPWLAGQCRISRGGNDTCFLEGLLGPLLPSLPPLGPSPLCLTPGPFLLGM
LSQLPRCQSSVPALAHPTRLHYLLRLLTFLLGPGAGGAEAQGMLGRALLLSSLPDNCSFW
DAFRPEGRRSVLRTIGEYLEQDEEQPTPSGFEPTVNPSSGISKMELLACFSPVLWDLLQR
EKSVWALQILVQAYLHMPPENLQQLVLSAEREAAQGFLTLMLQGKLQGKLQVPPSEEQAL
GRLTALLLQRYPRLTSQLFIDLSPLIPFLAVSDLMRFPPSLLANDSVLAAIRDYSPGMRP
EQKEALAKRLLAPELFGEVPAWPQELLWAVLPLLPHLPLENFLQLSPHQIQALEDSWPAA
GLGPGHARHVLRSLVNQSVQDGEEQVRRLGPLACFLSPEELQSLVPLSDPTGPVERGLLE
CAANGTLSPEGRVAYELLGVLRSSGGAVLSPRELRVWAPLFSQLGLRFLQELSEPQLRAM
LPVLQGTSVTPAQAVLLLGRLLPRHDLSLEELCSLHLLLPGLSPQTLQAIPRRVLVGACS
CLAPELSRLSACQTAALLQTFRVKDGVKNMGTTGAGPAVCIPGQQPIPTTWPDCLLPLLP
LKLLQLDSLALLANRRRYWELPWSEQQAQFLWKKMQVPTNLTLRNLQALGTLAGGMSCEF
LQQINSMVDFLEVVHMIYQLPTRVRGSLRACIWAELQRRMAMPEPEWTTVGPELNGLDSK
LLLDLPIQLMDRLSNESIMLVVELVQRAPEQLLALTPLHQAALAERALQNLAPKETPVSG
EVLETLGPLVGFLGTESTRQIPLQILLSHLSFCLGETFATELGWLLLQESVLGKPELWSQ
DEVEQAGRLVFTLSTEAISLIPREALGPETLERLLEKQQSWEQSRVGQLCRGPQLAAKKA
ALVAGVVRPAAEDLPEPVPNCADVRGTFPAACSATQIAEMELSDFKDCLTLFAGDPGLGP
EEPRAAMGKAKWLWGPPRGFGPEQILQLGRLLIGLGDQELQELILVDWGVLSTLGQIDGW
SSTQLRIVVSSFLRQSGRHVSHLDFVHLTALGYTLCGLRPEELQHISSWEFSQAALFLGT
LHLQCSEEQLEFLAHLFVLPGGFGPISNWGPEIFTEIGTIAAGIPDLALSALLRGQIQGV
TPLAISVIPPPKFAVVFSPIQLSSLASAQAVAVTPEQMAFLSPEQRRAVAWAQHEGKESP
EQQGRSTAWGLQDWSRPSWSLVLTISFLGHLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8VIM6	0.761	0.747	0.000	1809	0.867	0.849	Q8VIM6.pdb.gz	STRC_MOUSE Stereocilin OS=Mus musculus OX=10090 GN=Strc PE=2 SV=2
2	AFDB:A1L378	0.519	0.899	3.325E-100	1002	0.541	0.956	A1L378.pdb.gz	A1L378_HUMAN STRC protein OS=Homo sapiens OX=9606 GN=STRC PE=1 SV=1
3	AFDB:Q8K561	0.399	0.589	1.359E-28	1137	0.122	0.191	Q8K561.pdb.gz	OTOAN_MOUSE Otoancorin OS=Mus musculus OX=10090 GN=Otoa PE=2 SV=1
4	AFDB:Q7RTW8	0.389	0.568	1.747E-28	1153	0.127	0.195	Q7RTW8.pdb.gz	OTOAN_HUMAN Otoancorin OS=Homo sapiens OX=9606 GN=OTOA PE=1 SV=1
5	AFDB:Q387F9	0.076	0.098	2.804E-5	1220	0.103	0.150	Q387F9.pdb.gz	Q387F9_TRYB2 TATA-binding protein interacting (TIP20) domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0210 PE=3 SV=1
6	PDB:7sx3D	0.069	0.074	3.337E-5	1418	0.094	0.118	7sx3D.pdb.gz	Structural architecture of the human NALCN channelosome.
7	PDB:2xwuB	0.086	0.129	3.459E-5	910	0.080	0.155	2xwuB.pdb.gz
8	PDB:7kzpA	0.084	0.105	3.717E-5	1186	0.100	0.150	7kzpA.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
9	PDB:7qdrB	0.083	0.107	6.367E-5	1212	0.082	0.120	7qdrB.pdb.gz
10	PDB:7kzvV	0.080	0.105	6.600E-5	1155	0.075	0.115	7kzvV.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
11	PDB:7mq8LM	0.102	0.095	6.600E-5	2005	0.122	0.108	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:4c0qB	0.088	0.157	9.115E-5	749	0.063	0.150	4c0qB.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
13	PDB:7su3A	0.095	0.055	9.794E-5	3802	0.109	0.051	7su3A.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
14	PDB:6vaeA	0.084	0.102	1.215E-4	1198	0.099	0.146	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
15	PDB:7zf1B	0.087	0.114	1.259E-4	1179	0.088	0.132	7zf1B.pdb.gz
16	AFDB:Q9FNN3	0.062	0.094	1.560E-3	908	0.071	0.139	Q9FNN3.pdb.gz	ILP1_ARATH Transcriptional repressor ILP1 OS=Arabidopsis thaliana OX=3702 GN=ILP1 PE=1 SV=1
17	AFDB:Q9VJ35	0.048	0.049	1.867E-3	1732	0.089	0.091	Q9VJ35.pdb.gz	Q9VJ35_DROME LD01527p OS=Drosophila melanogaster OX=7227 GN=ssp3 PE=2 SV=3
18	AFDB:Q8GYU3	0.055	0.062	2.079E-3	1465	0.119	0.144	Q8GYU3.pdb.gz	IYO_ARATH Transcriptional elongation regulator MINIYO OS=Arabidopsis thaliana OX=3702 GN=IYO PE=1 SV=1
19	AFDB:Q57ZK7	0.084	0.118	2.872E-3	1031	0.068	0.116	Q57ZK7.pdb.gz	Q57ZK7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.550 PE=4 SV=1
20	AFDB:F8VQ70	0.052	0.060	1.496E-2	1398	0.081	0.102	F8VQ70.pdb.gz	F8VQ70_MOUSE S phase cyclin A-associated protein in the ER OS=Mus musculus OX=10090 GN=Scaper PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1L378	0.0	1207	1002	0.349	0.617	A1L378_HUMAN STRC protein OS=Homo sapiens OX=9606 GN=STRC PE=1 SV=1
2	Q8VIM6	0.0	2834	1809	0.861	0.843	STRC_MOUSE Stereocilin OS=Mus musculus OX=10090 GN=Strc PE=2 SV=2
3	Q8K561	2.97e-20	100	1137	0.045	0.069	OTOAN_MOUSE Otoancorin OS=Mus musculus OX=10090 GN=Otoa PE=2 SV=1
4	Q7RTW8	8.28e-17	89.4	1153	0.046	0.070	OTOAN_HUMAN Otoancorin OS=Homo sapiens OX=9606 GN=OTOA PE=1 SV=1
5	P32069	0.89	36.6	621	0.020	0.058	TRPX_ARATH Anthranilate synthase alpha subunit 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ASA2 PE=2 SV=1
6	Q92823	0.94	37.0	1304	0.030	0.041	NRCAM_HUMAN Neuronal cell adhesion molecule OS=Homo sapiens OX=9606 GN=NRCAM PE=1 SV=3
7	Q79EM8	1.7	35.4	332	0.016	0.084	PHDJ_NOCSK Trans-2'-carboxybenzalpyruvate hydratase-aldolase OS=Nocardioides sp. (strain KP7) OX=102632 GN=phdJ PE=1 SV=1
8	E1U8C5	2.9	35.0	848	0.020	0.042	E1U8C5_PIG Signal transducer and activator of transcription OS=Sus scrofa OX=9823 GN=stat6 PE=2 SV=1
9	E5F1H4	3.1	35.0	847	0.020	0.043	E5F1H4_PIG Signal transducer and activator of transcription OS=Sus scrofa OX=9823 GN=STAT6 PE=2 SV=1
10	B8LFF6	4.9	34.7	1414	0.014	0.018	B8LFF6_DANRE Receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=erbb4 PE=2 SV=1
11	Q8CAS9	5.4	34.3	866	0.016	0.033	PARP9_MOUSE Protein mono-ADP-ribosyltransferase PARP9 OS=Mus musculus OX=10090 GN=Parp9 PE=1 SV=2
12	Q2G1M6	6.5	33.9	400	0.007	0.033	SBNH_STAA8 2-[(L-alanin-3-ylcarbamoyl)methyl]-2-hydroxybutanedioate decarboxylase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=sbnH PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15494 SRCR_2	4.6e+02	12.9	Scavenger receptor cysteine-rich domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000401513

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371180	0.967	Cation channel sperm-associated protein 2
2	9606.ENSP00000406577	0.901	Creatine kinase U-type, mitochondrial
3	9606.ENSP00000300283	0.880	Creatine kinase, mitochondrial 1B
4	9606.ENSP00000400887	0.818	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1
5	9606.ENSP00000324775	0.812	Transmembrane inner ear expressed protein
6	9606.ENSP00000358430	0.770	Beta-tectorin
7	9606.ENSP00000348564	0.765	Codanin-1
8	9606.ENSP00000400895	0.747	Otogelin-like protein
9	9606.ENSP00000386647	0.736	Pejvakin
10	9606.ENSP00000382323	0.735	Otogelin
11	9606.ENSP00000482885	0.728	Phosphatidylinositol phosphatase PTPRQ
12	9606.ENSP00000205890	0.726	Unconventional myosin-XV
13	9606.ENSP00000272371	0.720	Otoferlin
14	9606.ENSP00000297784	0.702	Transmembrane channel-like protein 1
15	9606.ENSP00000372295	0.702	Gap junction beta-2 protein
16	9606.ENSP00000382090	0.701	Claudin-14
17	9606.ENSP00000381768	0.689	Cadherin-23
18	9606.ENSP00000363068	0.678	Protocadherin-15
19	9606.ENSP00000283228	0.674	Receptor-type tyrosine-protein phosphatase R
20	9606.ENSP00000363139	0.669	CD164 molecule like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.986	multicellular organismal process
GO:0007605	0.979	sensory perception of sound
GO:0009987	0.977	cellular process
GO:0016043	0.935	cellular component organization
GO:0048856	0.825	anatomical structure development
GO:0009612	0.812	response to mechanical stimulus
GO:0008544	0.804	epidermis development
GO:0048839	0.802	inner ear development
GO:0030855	0.780	epithelial cell differentiation
GO:0031175	0.755	neuron projection development
GO:0009913	0.728	epidermal cell differentiation
GO:0009790	0.725	embryo development
GO:0009887	0.724	animal organ morphogenesis
GO:0042490	0.720	mechanoreceptor differentiation
GO:0035315	0.720	hair cell differentiation
GO:0060119	0.687	inner ear receptor cell development
GO:0060122	0.681	inner ear receptor cell stereocilium organization
GO:0060117	0.681	auditory receptor cell development
GO:0050906	0.675	detection of stimulus involved in sensory perception
GO:0009582	0.674	detection of abiotic stimulus
GO:0009581	0.674	detection of external stimulus
GO:0050974	0.639	detection of mechanical stimulus involved in sensory perception
GO:0042472	0.633	inner ear morphogenesis
GO:0050910	0.591	detection of mechanical stimulus involved in sensory perception of sound
GO:0048667	0.589	cell morphogenesis involved in neuron differentiation
GO:0002093	0.562	auditory receptor cell morphogenesis
GO:0065007	0.360	biological regulation
GO:0050789	0.336	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0120025	0.995	plasma membrane bounded cell projection
GO:0043005	0.989	neuron projection
GO:0098858	0.985	actin-based cell projection
GO:0097730	0.977	non-motile cilium
GO:0032426	0.976	stereocilium tip
GO:0016020	0.973	membrane
GO:0005622	0.968	intracellular anatomical structure
GO:0071944	0.946	cell periphery
GO:0043229	0.944	intracellular organelle
GO:0043231	0.920	intracellular membrane-bounded organelle
GO:0005886	0.843	plasma membrane
GO:0060091	0.725	kinocilium
GO:0005737	0.662	cytoplasm
GO:0012505	0.543	endomembrane system
GO:0043233	0.506	organelle lumen
GO:0070013	0.485	intracellular organelle lumen
GO:0031981	0.390	nuclear lumen
GO:0005654	0.361	nucleoplasm
GO:0005576	0.338	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]