StarFunc result for job id A6NHM9

User Input

>input (499 residues)
MAHDLLFRLFPLLALGVPLQSNRLGPTSRLRYSRFLDPSNVIFLRWDFDLEAEIISFELQ
VRTAGWVGFGVTNRYTNVGSDLVVGGVLPNGNVYFSDQHLVEEDTLKEDGSQDAELLGLT
EDAVYTTMHFSRPFRSCDPHDLDITSNTVRVLAAYGLDDTLKLYRERTFVKSIFLLQVVH
PDDLDVPEDTIIHDLEITNFLIPEDDTTYACTFLPLPIVSEKHHIYKFEPKLVYHNETTV
HHILVYACGNASVLPTGISDCYGADPAFSLCSQVIVGSAVGGTSYQFPDDVGVSIGTPLD
PQWILEIHYSNFNNLPGVYDSSGIRVYYTSQLCKYDTDVLQLGFFTFPIHFIPPGAESFM
SYGLCRTEKFEEMNGAPMPDIQVYGYLLHTHLAGRALQAVQYRNGTQLRKICKDDSYDFN
LQETRDLPSRVEIKPGDELLVECHYQTLDRDSMTFGGPSTINEMCLIFLFYYPQNNISSC
MGYPDIIYVAHELGEEASE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6UVY6	0.886	0.725	5.721E-52	613	0.379	0.308	Q6UVY6.pdb.gz	MOXD1_HUMAN DBH-like monooxygenase protein 1 OS=Homo sapiens OX=9606 GN=MOXD1 PE=1 SV=1
2	AFDB:P09172	0.836	0.684	8.777E-46	617	0.299	0.241	P09172.pdb.gz	DOPO_HUMAN Dopamine beta-hydroxylase OS=Homo sapiens OX=9606 GN=DBH PE=1 SV=3
3	AFDB:Q64237	0.771	0.631	2.010E-45	622	0.297	0.238	Q64237.pdb.gz	DOPO_MOUSE Dopamine beta-hydroxylase OS=Mus musculus OX=10090 GN=Dbh PE=1 SV=2
4	AFDB:Q05754	0.774	0.634	8.140E-45	620	0.291	0.234	Q05754.pdb.gz	DOPO_RAT Dopamine beta-hydroxylase OS=Rattus norvegicus OX=10116 GN=Dbh PE=1 SV=1
5	AFDB:Q6NP60	0.864	0.576	2.544E-44	760	0.267	0.175	Q6NP60.pdb.gz	MOX12_DROME MOXD1 homolog 2 OS=Drosophila melanogaster OX=7227 GN=olf413 PE=2 SV=1
6	AFDB:A0A2R8QLP9	0.799	0.660	1.267E-43	614	0.287	0.233	A0A2R8QLP9.pdb.gz
7	AFDB:H0Z5G7	0.770	0.612	9.069E-43	643	0.285	0.221	H0Z5G7.pdb.gz	H0Z5G7_TAEGU Dopamine beta-hydroxylase OS=Taeniopygia guttata OX=59729 GN=DBH PE=3 SV=2
8	PDB:4zelA	0.815	0.744	9.573E-43	550	0.293	0.265	4zelA.pdb.gz	The crystal structure of human dopamine beta-hydroxylase at 2.9 angstrom resolution.
9	AFDB:P15101	0.762	0.637	1.303E-42	610	0.293	0.239	P15101.pdb.gz	DOPO_BOVIN Dopamine beta-hydroxylase OS=Bos taurus OX=9913 GN=DBH PE=1 SV=2
10	AFDB:Q86B61	0.807	0.609	1.611E-40	670	0.279	0.207	Q86B61.pdb.gz	TBH1_DROME Tyramine beta-hydroxylase OS=Drosophila melanogaster OX=7227 GN=Tbh PE=1 SV=1
11	AFDB:Q9XTQ6	0.768	0.597	2.781E-39	657	0.257	0.195	Q9XTQ6.pdb.gz	TBH1_CAEEL Tyramine beta-hydroxylase OS=Caenorhabditis elegans OX=6239 GN=tbh-1 PE=1 SV=3
12	PDB:3lxuX	0.125	0.070	3.996E-6	1217	0.086	0.035	3lxuX.pdb.gz
13	PDB:1tg7A	0.127	0.076	2.579E-5	971	0.098	0.050	1tg7A.pdb.gz	Crystal Structures of beta-Galactosidase from Penicillium sp. and its Complex with Galactose
14	PDB:4qi7A	0.218	0.142	2.047E-4	805	0.032	0.020	4qi7A.pdb.gz	Structural basis for cellobiose dehydrogenase action during oxidative cellulose degradation.
15	PDB:6vlsD	0.119	0.071	4.689E-4	963	0.086	0.045	6vlsD.pdb.gz
16	PDB:4g1eA	0.136	0.087	2.218E-3	964	0.100	0.052	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
17	PDB:2vvfA	0.260	0.413	3.723E-3	269	0.056	0.104	2vvfA.pdb.gz	Insights Into Virus Evolution and Membrane Biogenesis from the Structure of the Marine Lipid-Containing Bacteriophage Pm2.
18	PDB:7u05B	0.127	0.090	5.934E-3	815	0.114	0.070	7u05B.pdb.gz
19	PDB:3zmnA	0.107	0.201	1.163E-2	228	0.054	0.118	3zmnA.pdb.gz
20	PDB:4lnvB	0.084	0.051	1.163E-2	1063	0.110	0.052	4lnvB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6UVY6	5.49e-99	312	613	0.373	0.303	MOXD1_HUMAN DBH-like monooxygenase protein 1 OS=Homo sapiens OX=9606 GN=MOXD1 PE=1 SV=1
2	P09172	3.42e-70	237	617	0.305	0.246	DOPO_HUMAN Dopamine beta-hydroxylase OS=Homo sapiens OX=9606 GN=DBH PE=1 SV=3
3	P15101	5.18e-68	231	610	0.301	0.246	DOPO_BOVIN Dopamine beta-hydroxylase OS=Bos taurus OX=9913 GN=DBH PE=1 SV=2
4	Q05754	3.30e-67	229	620	0.301	0.242	DOPO_RAT Dopamine beta-hydroxylase OS=Rattus norvegicus OX=10116 GN=Dbh PE=1 SV=1
5	Q64237	1.37e-66	228	622	0.307	0.246	DOPO_MOUSE Dopamine beta-hydroxylase OS=Mus musculus OX=10090 GN=Dbh PE=1 SV=2
6	H0Z5G7	1.99e-63	219	643	0.295	0.229	H0Z5G7_TAEGU Dopamine beta-hydroxylase OS=Taeniopygia guttata OX=59729 GN=DBH PE=3 SV=2
7	B3DGL8	6.29e-60	209	614	0.281	0.228	B3DGL8_DANRE Dopamine beta-hydroxylase OS=Danio rerio OX=7955 GN=DBH PE=2 SV=1
8	Q6NP60	1.29e-55	200	760	0.275	0.180	MOX12_DROME MOXD1 homolog 2 OS=Drosophila melanogaster OX=7227 GN=olf413 PE=2 SV=1
9	Q86B61	2.83e-53	192	670	0.285	0.212	TBH1_DROME Tyramine beta-hydroxylase OS=Drosophila melanogaster OX=7227 GN=Tbh PE=1 SV=1
10	Q9XTQ6	9.21e-50	182	657	0.242	0.184	TBH1_CAEEL Tyramine beta-hydroxylase OS=Caenorhabditis elegans OX=6239 GN=tbh-1 PE=1 SV=3
11	P10731	2.73e-10	65.5	972	0.124	0.064	AMD_BOVIN Peptidyl-glycine alpha-amidating monooxygenase OS=Bos taurus OX=9913 GN=PAM PE=1 SV=2
12	P97467	5.87e-10	64.3	979	0.124	0.063	AMD_MOUSE Peptidyl-glycine alpha-amidating monooxygenase OS=Mus musculus OX=10090 GN=Pam PE=1 SV=2
13	P14925	1.12e-09	63.5	976	0.124	0.064	AMD_RAT Peptidylglycine alpha-amidating monooxygenase OS=Rattus norvegicus OX=10116 GN=Pam PE=1 SV=1
14	P19021	1.05e-08	60.5	973	0.116	0.060	AMD_HUMAN Peptidyl-glycine alpha-amidating monooxygenase OS=Homo sapiens OX=9606 GN=PAM PE=1 SV=2
15	O01404	2.69e-08	58.2	365	0.142	0.195	PHM_DROME Peptidylglycine alpha-hydroxylating monooxygenase OS=Drosophila melanogaster OX=7227 GN=Phm PE=1 SV=2
16	Q8TDQ7	0.65	34.7	276	0.050	0.091	GNPI2_HUMAN Glucosamine-6-phosphate isomerase 2 OS=Homo sapiens OX=9606 GN=GNPDA2 PE=1 SV=1
17	E9NA96	2.3	33.5	947	0.066	0.035	IR25A_DROME Ionotropic receptor 25a OS=Drosophila melanogaster OX=7227 GN=Ir25a PE=1 SV=1
18	F6X9B6	3.7	32.7	768	0.042	0.027	F6X9B6_MOUSE Nebulin (Fragment) OS=Mus musculus OX=10090 GN=Neb PE=1 SV=1
19	P46926	8.0	31.2	289	0.032	0.055	GNPI1_HUMAN Glucosamine-6-phosphate isomerase 1 OS=Homo sapiens OX=9606 GN=GNPDA1 PE=1 SV=1
20	A4FV08	8.1	31.2	289	0.032	0.055	GNPI1_BOVIN Glucosamine-6-phosphate isomerase 1 OS=Bos taurus OX=9913 GN=GNPDA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01082 Cu2_monooxygen	5.4e-28	109.3	Copper type II ascorbate-dependent monooxygenase, N-terminal domain
2	PF03712 Cu2_monoox_C	5.7e-32	121.9	Copper type II ascorbate-dependent monooxygenase, C-terminal domain
3	PF03351 DOMON	2.5e-15	68.2	DOMON domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003812469.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003810582.1	0.910	Dopa decarboxylase
2	9597.XP_003846137.2	0.901	Phenylethanolamine N-methyltransferase
3	9597.XP_003831553.1	0.785	Histidine decarboxylase
4	9597.XP_008963065.1	0.561	Belongs to the peptidase S1 family.
5	9597.XP_008963075.1	0.561	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.999	binding
GO:0016715	0.999	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced ascorbate as one donor, and incorporation of one atom of oxygen
GO:0005515	0.955	protein binding
GO:0046914	0.659	transition metal ion binding
GO:0005507	0.651	copper ion binding
GO:0004500	0.460	dopamine beta-monooxygenase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.974	organic substance metabolic process
GO:0006807	0.947	nitrogen compound metabolic process
GO:0009987	0.940	cellular process
GO:1901564	0.913	organonitrogen compound metabolic process
GO:0032501	0.843	multicellular organismal process
GO:0044237	0.821	cellular metabolic process
GO:0006725	0.802	cellular aromatic compound metabolic process
GO:1901360	0.779	organic cyclic compound metabolic process
GO:0018958	0.737	phenol-containing compound metabolic process
GO:0009308	0.531	amine metabolic process
GO:0006576	0.523	biogenic amine metabolic process
GO:0009058	0.519	biosynthetic process
GO:0046189	0.500	phenol-containing compound biosynthetic process
GO:0009712	0.470	catechol-containing compound metabolic process
GO:1901566	0.463	organonitrogen compound biosynthetic process
GO:0006584	0.452	catecholamine metabolic process
GO:0042423	0.434	catecholamine biosynthetic process
GO:0044238	0.305	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043227	0.998	membrane-bounded organelle
GO:0043229	0.998	intracellular organelle
GO:0012505	0.995	endomembrane system
GO:0043231	0.969	intracellular membrane-bounded organelle
GO:0016020	0.556	membrane
GO:0031090	0.342	organelle membrane
GO:0005829	0.323	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.17.-	0.999	With reduced ascorbate as one donor, and incorporation of one atom of oxygen.
RHEA:19117	0.460	dopamine + 2 L-ascorbate + O2 = (R)-noradrenaline + H2O + 2 monodehydro-L-ascorbate radical
EC:1.14.17.1	0.460	dopamine beta-monooxygenase.

[back to server]