StarFunc result for job id A6NHP3

User Input

>input (402 residues)
MDRTETRFRKRGQITGKITTSRQPHPQNEQSPQRSTSGYPLQEVVDDEMLGPSAPGVDPS
PPCRSLGWKRKREWSDESEEEPEKELAPEPEETWVVEMLCGLKMKLKQQRVSSILPEHHK
DFNSQLAPGVDPSPPHRSFCWKRKMEWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLK
MKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGFPS
WQYQRIHFFLALYLANDMEEDDEDSKQNIFHFLYRKNRSRIPLLRKPWFQLGHSMNPRAR
KNRSRIPLLRKRRFQLYRSTNPRARKNRSRIPLLRKRRFQLYRSMNSRARKNRSQIVLFQ
KRRFHFFCSMSCRAWVSPEELEEIQAYDPEHWVWARDRAHLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0CI01	0.772	0.772	1.023E-57	402	0.995	0.995	P0CI01.pdb.gz	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
2	AFDB:P0DTA3	0.418	0.619	3.548E-28	265	0.555	0.842	P0DTA3.pdb.gz	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
3	AFDB:A6NLX3	0.388	0.643	3.315E-22	237	0.405	0.688	A6NLX3.pdb.gz	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
4	AFDB:Q9NRI5	0.097	0.059	2.540E-1	854	0.201	0.095	Q9NRI5.pdb.gz	DISC1_HUMAN Disrupted in schizophrenia 1 protein OS=Homo sapiens OX=9606 GN=DISC1 PE=1 SV=3
5	AFDB:Q0WVU3	0.104	0.110	2.837E-1	375	0.124	0.133	Q0WVU3.pdb.gz	PHL5_ARATH Myb family transcription factor PHL5 OS=Arabidopsis thaliana OX=3702 GN=PHL5 PE=2 SV=1
6	AFDB:Q22695	0.124	0.137	3.538E-1	356	0.085	0.096	Q22695.pdb.gz	CD5R1_CAEEL Cyclin-dependent kinase 5 activator 1 OS=Caenorhabditis elegans OX=6239 GN=cdka-1 PE=2 SV=2
7	AFDB:Q01593	0.120	0.078	6.145E-1	720	0.102	0.057	Q01593.pdb.gz	ABI3_ARATH B3 domain-containing transcription factor ABI3 OS=Arabidopsis thaliana OX=3702 GN=ABI3 PE=1 SV=1
8	AFDB:P9WGI1	0.083	0.069	7.252E-1	528	0.082	0.062	P9WGI1.pdb.gz	SIGA_MYCTU RNA polymerase sigma factor SigA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=sigA PE=1 SV=1
9	AFDB:F4IL23	0.098	0.065	9.558E-1	709	0.147	0.083	F4IL23.pdb.gz	F4IL23_ARATH Agenet domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=DUF6 PE=1 SV=1
10	AFDB:Q8N715	0.081	0.059	1.128	623	0.147	0.095	Q8N715.pdb.gz	CC185_HUMAN Coiled-coil domain-containing protein 185 OS=Homo sapiens OX=9606 GN=CCDC185 PE=1 SV=2
11	PDB:6gzhB	0.151	0.223	2.177	252	0.045	0.071	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
12	PDB:6lojB	0.090	0.070	2.431	571	0.050	0.035	6lojB.pdb.gz	Substrate-binding destabilizes the hydrophobic cluster to relieve the autoinhibition of bacterial ubiquitin ligase IpaH9.8.
13	PDB:2w96A	0.148	0.223	2.569	249	0.030	0.048	2w96A.pdb.gz
14	PDB:1g3nC	0.103	0.169	2.869	233	0.040	0.069	1g3nC.pdb.gz
15	PDB:1o0lA	0.089	0.166	3.031	188	0.032	0.069	1o0lA.pdb.gz
16	PDB:3g33B	0.123	0.192	3.203	229	0.090	0.157	3g33B.pdb.gz
17	PDB:6jt0A	0.071	0.056	3.203	542	0.022	0.017	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
18	PDB:7pubFh	0.101	0.133	3.203	274	0.050	0.073	7pubFh.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
19	PDB:1sqfA	0.131	0.125	3.577	425	0.025	0.024	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate
20	PDB:6kvgA	0.129	0.193	3.995	256	0.027	0.043	6kvgA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0CI01	0.0	817	402	0.995	0.995	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
2	Q495Y8	0.0	820	402	0.998	0.998	SPDE2_HUMAN Speedy protein E2 OS=Homo sapiens OX=9606 GN=SPDYE2 PE=1 SV=2
3	P0DTA3	1.84e-116	342	265	0.460	0.698	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
4	A6NLX3	4.48e-67	214	237	0.303	0.515	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
5	Q5IBH6	8.80e-59	194	268	0.254	0.381	SPE4A_MOUSE Speedy protein E4A OS=Mus musculus OX=10090 GN=Spdye4a PE=1 SV=1
6	Q9PU13	2.27e-18	87.0	299	0.139	0.187	SPD1A_XENLA Speedy protein 1-A OS=Xenopus laevis OX=8355 GN=spdya-a PE=1 SV=2
7	Q9YGL1	2.25e-17	84.3	298	0.112	0.151	SPD1B_XENLA Speedy protein 1-B OS=Xenopus laevis OX=8355 GN=spdya-b PE=1 SV=1
8	Q5MJ68	5.26e-16	80.1	293	0.102	0.140	SPDYC_HUMAN Speedy protein C OS=Homo sapiens OX=9606 GN=SPDYC PE=1 SV=1
9	Q4R1K5	7.44e-13	70.9	311	0.100	0.129	Q4R1K5_PIG Rapid inducer of G2/M progression in oocytes OS=Sus scrofa OX=9823 GN=RINGO PE=2 SV=1
10	A0A384MTT5	1.08e-12	70.5	313	0.097	0.125	A0A384MTT5_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=SPDY1 PE=2 SV=1
11	Q5MJ70	1.08e-12	70.5	313	0.097	0.125	SPDYA_HUMAN Speedy protein A OS=Homo sapiens OX=9606 GN=SPDYA PE=1 SV=2
12	Q5IBH7	1.10e-12	70.5	310	0.139	0.181	SPDYA_MOUSE Speedy protein A OS=Mus musculus OX=10090 GN=Spdya PE=1 SV=2
13	Q961D9	2.6	33.1	1469	0.052	0.014	BCL9_DROME Protein BCL9 homolog OS=Drosophila melanogaster OX=7227 GN=lgs PE=1 SV=1
14	Q6WRI0	2.8	32.7	2623	0.055	0.008	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11357 Spy1	6.6e-51	183.5	Cell cycle regulatory protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000424058

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266970	0.800	Cyclin-dependent kinase 2
2	9606.ENSP00000378699	0.800	Cyclin-dependent kinase 1
3	9606.ENSP00000321656	0.600	M-phase inducer phosphatase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019899	0.405	enzyme binding
GO:0019901	0.395	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048518	0.995	positive regulation of biological process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0050794	0.988	regulation of cellular process
GO:0048522	0.980	positive regulation of cellular process
GO:0031323	0.980	regulation of cellular metabolic process
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0051726	0.970	regulation of cell cycle
GO:0080090	0.965	regulation of primary metabolic process
GO:0051246	0.911	regulation of protein metabolic process
GO:0009987	0.876	cellular process
GO:0009893	0.781	positive regulation of metabolic process
GO:0045859	0.775	regulation of protein kinase activity
GO:0022414	0.724	reproductive process
GO:0031325	0.695	positive regulation of cellular metabolic process
GO:0071704	0.679	organic substance metabolic process
GO:1904029	0.646	regulation of cyclin-dependent protein kinase activity
GO:0043170	0.634	macromolecule metabolic process
GO:0022402	0.580	cell cycle process
GO:0045787	0.551	positive regulation of cell cycle
GO:0006807	0.500	nitrogen compound metabolic process
GO:0044238	0.485	primary metabolic process
GO:0044237	0.485	cellular metabolic process
GO:0090304	0.462	nucleic acid metabolic process
GO:0051173	0.396	positive regulation of nitrogen compound metabolic process
GO:0010604	0.377	positive regulation of macromolecule metabolic process
GO:0050896	0.363	response to stimulus
GO:0016043	0.345	cellular component organization
GO:0010564	0.345	regulation of cell cycle process
GO:1901564	0.337	organonitrogen compound metabolic process
GO:0006996	0.336	organelle organization
GO:0033043	0.334	regulation of organelle organization
GO:0000079	0.314	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0006950	0.308	response to stress
GO:0051716	0.307	cellular response to stimulus
GO:0044260	0.307	cellular macromolecule metabolic process
GO:0019538	0.306	protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.998	nuclear lumen
GO:0005654	0.988	nucleoplasm
GO:0043232	0.948	intracellular non-membrane-bounded organelle
GO:0005737	0.923	cytoplasm
GO:0005829	0.898	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]